StarFunc result for job id Q9UHF7

User Input

>input (1281 residues)
MVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNHKEEH
SLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNFPSFPHDEVTDRNMLAFSSPAAGG
VCEPLKSPQRAEADDPQDMACTPSGDSLETKEDQKMSPKATEETGQAQSGQANCQGLSPV
SVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLI
KHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVFSGVLQDINSSRPV
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPN
KIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPL
DSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGLNPELNDKLSRGSV
INQNDLAKSSEGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQFCDFRYSKSHGPDV
IVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLL
HLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQEANHLQGSDGQQSV
KESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSLLEHFNTVHCQEQD
ITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKREKLEEKDGLKEKV
WTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTLRDSPNVEAAHLAR
PIYGLAVETKGFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLRRRRGSGVFCANCL
TTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQA
EQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPV
LVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRPAKHPNY
SPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQN
YVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVV
KTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTT
HIQRGLHRNNAQVEKNGKPKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q925H1	0.220	0.220	0.000	1281	0.931	0.931	Q925H1.pdb.gz	TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus OX=10090 GN=Trps1 PE=1 SV=1
2	AFDB:P52172	0.048	0.049	7.751E-10	1264	0.155	0.157	P52172.pdb.gz	SRP_DROME Box A-binding factor OS=Drosophila melanogaster OX=7227 GN=srp PE=1 SV=2
3	AFDB:O75362	0.051	0.057	6.171E-9	1048	0.146	0.178	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
4	AFDB:Q92618	0.060	0.063	3.477E-8	1163	0.131	0.144	Q92618.pdb.gz	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
5	AFDB:Q8NAP3	0.068	0.072	9.837E-7	1195	0.122	0.131	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
6	AFDB:Q4WCP6	0.048	0.063	3.299E-6	881	0.121	0.176	Q4WCP6.pdb.gz	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
7	AFDB:Q90ZW5	0.056	0.057	4.939E-6	1261	0.133	0.135	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
8	AFDB:Q10280	0.051	0.071	1.316E-5	855	0.113	0.170	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
9	AFDB:A0MWC1	0.052	0.057	1.394E-5	1091	0.123	0.145	A0MWC1.pdb.gz	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
10	AFDB:A0A1W2PQA1	0.052	0.059	2.086E-5	1069	0.120	0.144	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
11	PDB:4c2mI	0.032	0.244	2.422E-2	124	0.018	0.185	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
12	PDB:7z1lI	0.031	0.249	1.288E-1	110	0.014	0.164	7z1lI.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
13	PDB:5fj9I	0.031	0.310	4.848E-1	92	0.006	0.087	5fj9I.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
14	PDB:6hlqI	0.030	0.262	6.467E-1	111	0.015	0.171	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
15	PDB:7eu0I	0.033	0.214	6.467E-1	113	0.011	0.124	7eu0I.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
16	PDB:5zwmv	0.032	0.127	9.139E-1	174	0.018	0.132	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
17	PDB:3ul5D	0.026	0.194	1.291	84	0.012	0.190	3ul5D.pdb.gz
18	PDB:3w5kB	0.026	0.198	1.449	110	0.008	0.091	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
19	PDB:4btsA9	0.025	0.175	1.449	93	0.011	0.151	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
20	PDB:7oqyY	0.015	0.135	1.825	92	0.012	0.163	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5RFF3	0.0	1372	1035	0.511	0.633	E5RFF3_HUMAN Transcriptional repressor GATA binding 1 OS=Homo sapiens OX=9606 GN=TRPS1 PE=1 SV=1
2	Q925H1	0.0	2472	1281	0.931	0.931	TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus OX=10090 GN=Trps1 PE=1 SV=1
3	Q9UHF7	0.0	2665	1281	1.000	1.000	TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens OX=9606 GN=TRPS1 PE=1 SV=2
4	A0A0A0MRA0	1.76e-14	77.0	249	0.022	0.112	A0A0A0MRA0_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
5	P97489	2.10e-14	79.3	404	0.037	0.116	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
6	R9R4D9	3.90e-14	76.3	268	0.022	0.104	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
7	P43691	4.33e-14	78.2	380	0.033	0.111	GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1
8	P43694	4.65e-14	78.6	442	0.033	0.095	GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2
9	O93581	4.76e-14	79.0	537	0.026	0.061	O93581_DANRE DNA-binding protein Ikaros OS=Danio rerio OX=7955 GN=znfn1a1 PE=2 SV=1
10	P46152	4.85e-14	78.6	440	0.033	0.095	GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus OX=10116 GN=Gata4 PE=1 SV=1
11	I3LUZ9	5.02e-14	78.6	443	0.033	0.095	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
12	Q08369	5.42e-14	78.2	441	0.033	0.095	GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus OX=10090 GN=Gata4 PE=1 SV=4
13	O42410	6.29e-14	78.6	518	0.031	0.077	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
14	Q91677	6.89e-14	77.4	392	0.034	0.112	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
15	A0A087WU46	8.06e-14	76.6	336	0.022	0.083	A0A087WU46_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
16	A0A087WZ09	1.23e-13	77.0	441	0.033	0.095	A0A087WZ09_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=1
17	Q91428	1.50e-13	77.0	438	0.030	0.087	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
18	Q8MIM5	2.20e-13	76.3	442	0.032	0.093	Q8MIM5_PIG Transcription factor GATA-4 OS=Sus scrofa OX=9823 PE=2 SV=1
19	Q5SWU0	2.41e-13	76.3	428	0.022	0.065	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
20	Q13422	3.69e-13	76.3	519	0.022	0.054	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17003 Actin_micro	1.3e+02	13.2	Putative actin-like family
2	PF00320 GATA	7.2e-09	46.4	GATA zinc finger
3	PF18217 Zap1_zf2	83	14.6	Zap1 zinc finger 2
4	PF18387 zf_C2H2_ZHX	1.7e+02	13.3	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376297	0.854	Dynein light chain 1, cytoplasmic
2	9606.ENSP00000367446	0.820	Exostosin-1
3	9606.ENSP00000362649	0.778	Histone deacetylase 1
4	9606.ENSP00000297405	0.774	CUB and sushi domain-containing protein 3
5	9606.ENSP00000429931	0.765	Eukaryotic translation initiation factor 3 subunit H
6	9606.ENSP00000349508	0.743	Chromodomain-helicase-DNA-binding protein 4
7	9606.ENSP00000262219	0.720	Annexin A13
8	9606.ENSP00000348056	0.708	SUMO-conjugating enzyme UBC9
9	9606.ENSP00000379258	0.701	Transcriptional activator GLI3
10	9606.ENSP00000405330	0.592	Estrogen receptor
11	9606.ENSP00000341361	0.587	E3 ubiquitin-protein ligase RNF13
12	9606.ENSP00000378132	0.576	Iroquois-class homeodomain protein IRX-5
13	9606.ENSP00000379241	0.567	Leucine-rich repeat-containing protein 2
14	9606.ENSP00000216923	0.557	Zinc finger protein 64 homolog, isoforms 1 and 2
15	9606.ENSP00000273320	0.556	Zinc finger protein with KRAB and SCAN domains 7
16	9606.ENSP00000426503	0.553	E3 ubiquitin-protein ligase RNF4
17	9606.ENSP00000311825	0.543	C-terminal-binding protein 2
18	9606.ENSP00000295731	0.535	Indian hedgehog protein
19	9606.ENSP00000341684	0.528	Coiled-coil domain containing 15
20	9606.ENSP00000382800	0.514	Runt-related transcription factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.976	nucleic acid binding
GO:0003677	0.971	DNA binding
GO:0043565	0.934	sequence-specific DNA binding
GO:0140110	0.861	transcription regulator activity
GO:0000976	0.842	transcription cis-regulatory region binding
GO:0003700	0.837	DNA-binding transcription factor activity
GO:0043167	0.742	ion binding
GO:0043169	0.671	cation binding
GO:0046872	0.625	metal ion binding
GO:0000977	0.362	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0046914	0.351	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.988	regulation of metabolic process
GO:0050794	0.985	regulation of cellular process
GO:1903507	0.981	negative regulation of nucleic acid-templated transcription
GO:0007275	0.980	multicellular organism development
GO:0048731	0.974	system development
GO:0045892	0.970	negative regulation of DNA-templated transcription
GO:0001501	0.960	skeletal system development
GO:0009987	0.720	cellular process
GO:0006357	0.681	regulation of transcription by RNA polymerase II
GO:0048518	0.512	positive regulation of biological process
GO:0000122	0.498	negative regulation of transcription by RNA polymerase II
GO:0048522	0.496	positive regulation of cellular process
GO:0050896	0.456	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.977	nucleoplasm
GO:0032991	0.933	protein-containing complex
GO:0043232	0.923	intracellular non-membrane-bounded organelle
GO:0005737	0.696	cytoplasm
GO:0005694	0.633	chromosome
GO:0000785	0.499	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]