StarFunc result for job id Q9UHH9

User Input

>input (426 residues)
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHH
VLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS
MKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQ
IRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR
RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESA
DESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI
SEESGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80V72	0.951	0.906	9.264E-75	448	0.965	0.917	Q80V72.pdb.gz	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
2	AFDB:B2RCP4	0.868	0.868	6.329E-72	426	1.000	1.000	B2RCP4.pdb.gz	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
3	AFDB:Q6PBN6	0.807	0.744	3.157E-54	463	0.643	0.592	Q6PBN6.pdb.gz	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
4	AFDB:A0A024R2X2	0.723	0.699	6.878E-43	441	0.477	0.460	A0A024R2X2.pdb.gz
5	AFDB:Q8BWD2	0.725	0.778	5.529E-42	396	0.413	0.444	Q8BWD2.pdb.gz	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
6	AFDB:Q96PC2	0.734	0.761	5.534E-41	410	0.441	0.459	Q96PC2.pdb.gz	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
7	AFDB:O74561	0.591	0.267	2.616E-22	967	0.317	0.140	O74561.pdb.gz	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
8	AFDB:Q12494	0.550	0.229	5.968E-20	1050	0.282	0.114	Q12494.pdb.gz	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
9	AFDB:P07250	0.504	0.601	6.673E-18	355	0.209	0.251	P07250.pdb.gz	IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG82 PE=1 SV=1
10	AFDB:Q8NFU5	0.524	0.536	1.361E-17	416	0.230	0.236	Q8NFU5.pdb.gz	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
11	PDB:2iewA	0.393	0.633	4.514E-15	258	0.141	0.233	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.
12	PDB:4frfA	0.385	0.749	4.527E-12	214	0.131	0.262	4frfA.pdb.gz
13	PDB:1h6qA	0.076	0.151	7.096E-1	168	0.066	0.167	1h6qA.pdb.gz
14	PDB:6eeiB	0.076	0.071	8.837E-1	471	0.040	0.036	6eeiB.pdb.gz	Structural basis for divergent and convergent evolution of catalytic machineries in plant aromatic amino acid decarboxylase proteins.
15	PDB:1msvB	0.077	0.083	1.529	320	0.040	0.053	1msvB.pdb.gz
16	PDB:7enaq	0.068	0.056	1.616	555	0.045	0.034	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:6khnA	0.079	0.071	2.125	490	0.047	0.041	6khnA.pdb.gz	Crystal structure ofOryza sativaTDC reveals the substrate specificity for TDC-mediated melatonin biosynthesis.
18	PDB:2lgcA	0.085	0.096	2.505	359	0.021	0.025	2lgcA.pdb.gz
19	PDB:3uzsA	0.065	0.051	2.505	609	0.023	0.016	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:4bvuA	0.076	0.140	2.505	171	0.038	0.094	4bvuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RCP4	0.0	890	426	1.000	1.000	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
2	Q80V72	0.0	852	448	0.967	0.920	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
3	Q9R0U1	0.0	858	425	0.962	0.965	IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus OX=10116 GN=Ip6k2 PE=2 SV=2
4	Q9UHH9	0.0	890	426	1.000	1.000	IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=IP6K2 PE=1 SV=2
5	Q6PBN6	4.15e-166	476	463	0.552	0.508	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
6	Q9ESM0	3.46e-135	396	433	0.493	0.485	IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ip6k1 PE=2 SV=1
7	Q92551	7.39e-134	393	441	0.498	0.481	IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=3
8	Q6PD10	3.94e-133	391	433	0.481	0.473	IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus OX=10090 GN=Ip6k1 PE=2 SV=1
9	Q96PC2	1.13e-120	358	410	0.437	0.454	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
10	Q8BWD2	1.28e-110	332	396	0.425	0.457	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
11	C9JNA8	6.00e-74	234	274	0.296	0.460	C9JNA8_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=1
12	O74561	8.94e-29	121	967	0.181	0.080	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
13	Q12494	3.68e-22	101	1050	0.171	0.070	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
14	Q57X56	4.19e-20	95.1	756	0.155	0.087	Q57X56_TRYB2 Kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.1100 PE=3 SV=1
15	Q99NI4	4.66e-20	93.6	396	0.113	0.121	IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus OX=10116 GN=Ipmk PE=1 SV=1
16	Q7TT16	4.98e-20	93.6	396	0.113	0.121	IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus OX=10090 GN=Ipmk PE=1 SV=1
17	Q8MRX9	7.05e-20	91.7	309	0.176	0.243	Q8MRX9_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=2 SV=1
18	Q9VPR6	1.09e-19	91.3	309	0.178	0.246	Q9VPR6_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=3 SV=2
19	Q8NFU5	1.38e-19	92.4	416	0.110	0.113	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
20	Q55AP4	1.14e-18	88.2	307	0.164	0.228	Q55AP4_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271760 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03770 IPK	1.8e-58	209.2	Inositol polyphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000010963

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000019415	0.975	Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate)
2	9555.ENSPANP00000014675	0.970	Uncharacterized protein
3	9555.ENSPANP00000000832	0.965	Uncharacterized protein
4	9555.ENSPANP00000011437	0.949	Kinase
5	9555.ENSPANP00000012452	0.949	Kinase
6	9555.ENSPANP00000020530	0.864	Multiple inositol-polyphosphate phosphatase 1
7	9555.ENSPANP00000001694	0.849	Inositol polyphosphate phosphatase-like 1
8	9555.ENSPANP00000018391	0.813	Inositol polyphosphate-5-phosphatase, 75kDa
9	9555.ENSPANP00000013241	0.745	Heat shock protein 90kDa alpha (cytosolic), class A member 1
10	9555.ENSPANP00000000368	0.655	Syntaxin binding protein 5-like
11	9555.ENSPANP00000008678	0.642	Tubulin folding cofactor E
12	9555.ENSPANP00000006950	0.617	Adenosine deaminase, tRNA-specific 1
13	9555.ENSPANP00000012814	0.609	Heat shock protein 90kDa alpha (cytosolic), class B member 1
14	9555.ENSPANP00000018523	0.606	Uncharacterized protein
15	9555.ENSPANP00000002589	0.581	Interferon, alpha-inducible protein 6
16	9555.ENSPANP00000013105	0.577	Inositol-tetrakisphosphate 1-kinase
17	9555.ENSPANP00000006805	0.576	Adenosine deaminase, RNA-specific
18	9555.ENSPANP00000012389	0.572	Proteasome (prosome, macropain) subunit, beta type, 8
19	9555.ENSPANP00000019506	0.569	ISG15 ubiquitin-like modifier
20	9555.ENSPANP00000012925	0.567	MX dynamin-like GTPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016776	1.000	phosphotransferase activity, phosphate group as acceptor
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0000827	0.959	inositol-1,3,4,5,6-pentakisphosphate kinase activity
GO:0000828	0.811	inositol hexakisphosphate kinase activity
GO:0000829	0.682	inositol heptakisphosphate kinase activity
GO:0052839	0.575	inositol diphosphate tetrakisphosphate kinase activity
GO:0052836	0.575	inositol 5-diphosphate pentakisphosphate 5-kinase activity
GO:0008440	0.480	inositol-1,4,5-trisphosphate 3-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050789	0.979	regulation of biological process
GO:0071704	0.950	organic substance metabolic process
GO:0044237	0.942	cellular metabolic process
GO:0044238	0.938	primary metabolic process
GO:0050794	0.881	regulation of cellular process
GO:0043647	0.868	inositol phosphate metabolic process
GO:0050896	0.825	response to stimulus
GO:0048518	0.761	positive regulation of biological process
GO:0051179	0.644	localization
GO:0046486	0.620	glycerolipid metabolic process
GO:0015698	0.613	inorganic anion transport
GO:0048519	0.606	negative regulation of biological process
GO:0009058	0.553	biosynthetic process
GO:0006817	0.546	phosphate ion transport
GO:1901576	0.513	organic substance biosynthetic process
GO:0048522	0.482	positive regulation of cellular process
GO:0051716	0.480	cellular response to stimulus
GO:0048523	0.439	negative regulation of cellular process
GO:0019222	0.383	regulation of metabolic process
GO:0046488	0.335	phosphatidylinositol metabolic process
GO:0042221	0.318	response to chemical
GO:0090407	0.314	organophosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.989	nucleoplasm
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005737	0.857	cytoplasm
GO:0005730	0.739	nucleolus
GO:0001650	0.732	fibrillar center
GO:0030054	0.605	cell junction
GO:0005829	0.386	cytosol
GO:0016020	0.330	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.-	1.000	Phosphotransferases with a phosphate group as acceptor.
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.4.21	0.959	inositol-hexakisphosphate 5-kinase.
RHEA:11020	0.480	1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + H(+)
EC:2.7.1.127	0.480	inositol-trisphosphate 3-kinase.

[back to server]