StarFunc result for job id Q9UHI6

User Input

>input (824 residues)
MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAE
PADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIA
LDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKK
CHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQML
AVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKVVNSYPLAHKVFEEKTQHL
QELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLDAMAKLKHFHC
RVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEEN
MMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIE
RTLQIQKAHGDHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDR
QSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEH
YIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVIEQRVPVLASSSQSGDSESDSDSYS
SRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMK
TRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAY
YRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHI6	1.000	1.000	0.000	824	1.000	1.000	Q9UHI6.pdb.gz	DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2
2	AFDB:Q9V3C4	0.485	0.390	3.932E-45	1028	0.222	0.178	Q9V3C4.pdb.gz	Q9V3C4_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Gem3 PE=1 SV=1
3	PDB:3ex7C	0.436	0.903	1.918E-35	392	0.161	0.339	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
4	PDB:7pq0B	0.253	0.525	4.063E-32	385	0.169	0.361	7pq0B.pdb.gz
5	PDB:1fuuB	0.249	0.529	1.066E-31	380	0.166	0.361	1fuuB.pdb.gz
6	PDB:7pliA	0.428	0.759	1.128E-31	457	0.141	0.254	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
7	AFDB:A0A5H1ZRQ2	0.423	0.474	6.096E-31	731	0.172	0.194	A0A5H1ZRQ2.pdb.gz	A0A5H1ZRQ2_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2
8	PDB:7v2yF	0.337	0.632	1.482E-29	376	0.150	0.330	7v2yF.pdb.gz
9	PDB:1xtkA	0.324	0.576	1.860E-29	382	0.167	0.361	1xtkA.pdb.gz
10	PDB:7evoE	0.245	0.434	3.636E-27	455	0.121	0.220	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
11	PDB:2j0uB	0.240	0.560	8.046E-27	347	0.146	0.346	2j0uB.pdb.gz	The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna
12	AFDB:Q8LA13	0.422	0.560	1.103E-24	612	0.153	0.206	Q8LA13.pdb.gz	RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana OX=3702 GN=RH11 PE=1 SV=1
13	PDB:7oi6x	0.384	0.808	5.936E-23	374	0.124	0.273	7oi6x.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.
14	PDB:7evnE	0.240	0.399	9.344E-23	486	0.123	0.208	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
15	AFDB:Q5T890	0.353	0.195	9.046E-14	1561	0.136	0.072	Q5T890.pdb.gz	ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2
16	AFDB:Q381X2	0.336	0.207	1.177E-9	1408	0.097	0.057	Q381X2.pdb.gz	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
17	AFDB:Q9VTE2	0.174	0.150	1.815E-5	962	0.115	0.099	Q9VTE2.pdb.gz	SUUR_DROME Protein suppressor of underreplication OS=Drosophila melanogaster OX=7227 GN=SuUR PE=1 SV=3
18	AFDB:Q9LK10	0.330	0.248	2.700E-5	1132	0.093	0.068	Q9LK10.pdb.gz	CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana OX=3702 GN=CLSY4 PE=1 SV=1
19	AFDB:B0R0I6	0.325	0.117	3.200E-5	2511	0.084	0.027	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
20	AFDB:O94421	0.316	0.165	9.403E-5	1680	0.080	0.039	O94421.pdb.gz	SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf22 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MAM8	0.0	1355	824	0.835	0.835	F1MAM8_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx20 PE=1 SV=1
2	Q9JIK3	0.0	580	406	0.373	0.756	Q9JIK3_RAT Regulator of steroidogenic factor-1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
3	Q9JJY4	0.0	1325	825	0.818	0.817	DDX20_MOUSE Probable ATP-dependent RNA helicase DDX20 OS=Mus musculus OX=10090 GN=Ddx20 PE=1 SV=2
4	Q9UHI6	0.0	1721	824	1.000	1.000	DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2
5	Q9V3C4	2.38e-76	270	1028	0.170	0.136	Q9V3C4_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Gem3 PE=1 SV=1
6	Q9VHS8	1.23e-74	250	399	0.171	0.353	IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster OX=7227 GN=CG7483 PE=1 SV=1
7	O44781	1.31e-73	248	399	0.164	0.338	O44781_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=CELE_F33D11.10 PE=1 SV=1
8	Q10055	5.83e-72	243	394	0.166	0.348	FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif412 PE=1 SV=1
9	Q38BK1	2.15e-71	242	406	0.174	0.352	Q38BK1_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3290 PE=3 SV=1
10	P41376	7.71e-71	241	412	0.166	0.333	IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana OX=3702 GN=EIF4A1 PE=1 SV=1
11	Q8IKF0	1.27e-70	239	398	0.154	0.319	Q8IKF0_PLAF7 RNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1468700 PE=3 SV=1
12	Q9CAI7	2.16e-70	239	414	0.167	0.333	IF4A3_ARATH Eukaryotic initiation factor 4A-3 OS=Arabidopsis thaliana OX=3702 GN=TIF4A-3 PE=1 SV=1
13	P39517	2.45e-70	242	506	0.181	0.294	DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DHH1 PE=1 SV=1
14	I1GWP1	2.60e-70	239	414	0.166	0.331	I1GWP1_BRADI ATP-dependent RNA helicase OS=Brachypodium distachyon OX=15368 GN=100844546 PE=3 SV=1
15	O97285	5.47e-70	239	433	0.175	0.333	O97285_PLAF7 ATP-dependent RNA helicase DDX6 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320800 PE=3 SV=1
16	Q91VC3	5.66e-70	238	411	0.166	0.333	IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus OX=10090 GN=Eif4a3 PE=1 SV=3
17	P41377	7.37e-70	238	412	0.165	0.330	IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana OX=3702 GN=TIF4A-2 PE=1 SV=1
18	F4JEL4	8.00e-70	238	415	0.161	0.320	F4JEL4_ARATH Eukaryotic translation initiation factor 4A1 OS=Arabidopsis thaliana OX=3702 GN=EIF4A1 PE=1 SV=1
19	Q3B8Q2	8.45e-70	238	411	0.166	0.333	IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus OX=10116 GN=Eif4a3 PE=1 SV=1
20	P38919	8.89e-70	238	411	0.166	0.333	IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	52	15.5	AAA domain
2	PF13604 AAA_30	1.1e+02	14.0	AAA domain
3	PF00270 DEAD	1.1e-28	111.7	DEAD/DEAH box helicase
4	PF00271 Helicase_C	5.5e-21	86.4	Helicase conserved C-terminal domain
5	PF04851 ResIII	0.092	24.2	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308533	0.999	Gem-associated protein 2
2	9606.ENSP00000321706	0.999	Gem-associated protein 4
3	9606.ENSP00000370083	0.999	Survival of motor neuron 1, telomeric
4	9606.ENSP00000370119	0.999	Survival motor neuron protein
5	9606.ENSP00000285873	0.998	Gem-associated protein 5
6	9606.ENSP00000281950	0.996	Gem-associated protein 6
7	9606.ENSP00000392270	0.996	Serine-threonine kinase receptor-associated protein
8	9606.ENSP00000270257	0.995	Gem-associated protein 7
9	9606.ENSP00000369895	0.995	Gem-associated protein 8
10	9606.ENSP00000266735	0.972	Small nuclear ribonucleoprotein F
11	9606.ENSP00000272348	0.971	Small nuclear ribonucleoprotein G
12	9606.ENSP00000220592	0.969	Protein argonaute-2
13	9606.ENSP00000300413	0.969	Small nuclear ribonucleoprotein Sm D1
14	9606.ENSP00000260129	0.967	Trimethylguanosine synthase
15	9606.ENSP00000400591	0.966	Small nuclear ribonucleoprotein E
16	9606.ENSP00000357175	0.965	ETS translocation variant 3
17	9606.ENSP00000412566	0.961	Small nuclear ribonucleoprotein-associated proteins B and B
18	9606.ENSP00000215829	0.958	Small nuclear ribonucleoprotein Sm D3
19	9606.ENSP00000430432	0.958	Histone deacetylase 2
20	9606.ENSP00000342374	0.955	Small nuclear ribonucleoprotein Sm D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004386	0.999	helicase activity
GO:0008186	0.995	ATP-dependent activity, acting on RNA
GO:0140098	0.995	catalytic activity, acting on RNA
GO:0003724	0.993	RNA helicase activity
GO:1901363	0.964	heterocyclic compound binding
GO:0097159	0.964	organic cyclic compound binding
GO:0003676	0.952	nucleic acid binding
GO:0008134	0.869	transcription factor binding
GO:0140297	0.853	DNA-binding transcription factor binding
GO:0003723	0.841	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0010468	0.915	regulation of gene expression
GO:0071704	0.907	organic substance metabolic process
GO:0044238	0.904	primary metabolic process
GO:0010558	0.897	negative regulation of macromolecule biosynthetic process
GO:0006807	0.887	nitrogen compound metabolic process
GO:0051172	0.886	negative regulation of nitrogen compound metabolic process
GO:0031327	0.886	negative regulation of cellular biosynthetic process
GO:0044237	0.879	cellular metabolic process
GO:0043170	0.871	macromolecule metabolic process
GO:0045934	0.871	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.850	negative regulation of RNA metabolic process
GO:2001141	0.849	regulation of RNA biosynthetic process
GO:1903507	0.834	negative regulation of nucleic acid-templated transcription
GO:0034641	0.820	cellular nitrogen compound metabolic process
GO:0045892	0.811	negative regulation of DNA-templated transcription
GO:0006139	0.785	nucleobase-containing compound metabolic process
GO:0090304	0.769	nucleic acid metabolic process
GO:0016070	0.702	RNA metabolic process
GO:0010467	0.696	gene expression
GO:0071840	0.686	cellular component organization or biogenesis
GO:0006396	0.666	RNA processing
GO:0048518	0.641	positive regulation of biological process
GO:0016071	0.608	mRNA metabolic process
GO:0044085	0.592	cellular component biogenesis
GO:0016043	0.583	cellular component organization
GO:0048522	0.582	positive regulation of cellular process
GO:0000377	0.540	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.526	mRNA splicing, via spliceosome
GO:0022607	0.519	cellular component assembly
GO:0022613	0.494	ribonucleoprotein complex biogenesis
GO:0043933	0.465	protein-containing complex organization
GO:0065003	0.387	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.997	cytosol
GO:0016020	0.988	membrane
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0140513	0.930	nuclear protein-containing complex
GO:0005856	0.503	cytoskeleton
GO:0034719	0.497	SMN-Sm protein complex
GO:0032797	0.342	SMN complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.993	RNA helicase.

[back to server]