StarFunc result for job id Q9UHI8

User Input

>input (967 residues)
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59384	0.612	0.623	0.000	950	0.490	0.499	P59384.pdb.gz	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
2	AFDB:P97857	0.780	0.779	0.000	968	0.819	0.818	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
3	AFDB:Q9UHI8	1.000	1.000	0.000	967	1.000	1.000	Q9UHI8.pdb.gz	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
4	AFDB:Q9UP79	0.697	0.755	0.000	889	0.458	0.498	Q9UP79.pdb.gz	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
5	AFDB:P59511	0.619	0.330	2.835E-99	1906	0.400	0.203	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
6	AFDB:Q8BNJ2	0.628	0.724	3.558E-98	833	0.416	0.483	Q8BNJ2.pdb.gz	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
7	AFDB:F1R6Q4	0.623	0.426	5.212E-97	1461	0.380	0.251	F1R6Q4.pdb.gz
8	AFDB:Q19791	0.582	0.283	7.945E-89	2150	0.359	0.161	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
9	AFDB:Q8TE60	0.554	0.449	7.694E-83	1221	0.331	0.262	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
10	AFDB:E7FEJ5	0.512	0.411	9.959E-83	1244	0.322	0.250	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
11	PDB:4q1lA	0.182	0.813	3.285E-11	202	0.062	0.297	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:7ufgA	0.156	0.135	1.860E-6	1151	0.118	0.099	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:1w0rA	0.053	0.106	2.172E-6	442	0.077	0.167	1w0rA.pdb.gz
14	PDB:2x7mA	0.136	0.574	2.869E-5	180	0.041	0.222	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:7ufgB	0.166	0.141	4.336E-5	1182	0.128	0.105	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:3t5oA	0.066	0.072	1.451E-3	871	0.026	0.029	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:4a5wB	0.076	0.083	1.451E-3	871	0.029	0.032	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
18	PDB:4axqA	0.120	0.541	1.694E-3	163	0.032	0.190	4axqA.pdb.gz	Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
19	PDB:6oj0Z	0.084	0.330	3.674E-3	180	0.019	0.100	6oj0Z.pdb.gz
20	PDB:4e0sB	0.075	0.080	3.869E-3	898	0.027	0.029	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PUN6	0.0	622	1931	0.359	0.180	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	F1SFS3	0.0	593	2000	0.354	0.171	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
3	G3V673	0.0	705	927	0.386	0.402	G3V673_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=4 SV=1
4	O75173	0.0	754	837	0.417	0.481	ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=3
5	P59384	0.0	926	950	0.498	0.507	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
6	P59510	0.0	617	1910	0.362	0.183	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	P59511	0.0	662	1906	0.373	0.189	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	P97857	0.0	1624	968	0.824	0.823	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
9	Q6TY19	0.0	705	928	0.387	0.403	Q6TY19_RAT ADAMTS5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=2 SV=1
10	Q8BNJ2	0.0	752	833	0.419	0.486	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
11	Q9ESP7	0.0	722	630	0.360	0.552	ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Adamts4 PE=2 SV=2
12	Q9P2N4	0.0	650	1935	0.366	0.183	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
13	Q9R001	0.0	704	930	0.389	0.404	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
14	Q9TT93	0.0	746	839	0.415	0.478	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
15	Q9UHI8	0.0	2012	967	1.000	1.000	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
16	Q9UNA0	0.0	703	930	0.389	0.404	ATS5_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Homo sapiens OX=9606 GN=ADAMTS5 PE=1 SV=2
17	Q9UP79	0.0	846	889	0.457	0.497	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
18	Q9WUQ1	0.0	1631	967	0.825	0.825	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
19	Q19791	1.99e-175	563	2150	0.323	0.145	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
20	H2L2A7	9.06e-172	553	2165	0.323	0.144	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	4.6e-19	80.0	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	4.8e-06	37.9	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	3.7e-26	103.1	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	1.1e-19	82.5	Reprolysin family propeptide
5	PF01421 Reprolysin	5.1e-17	74.0	Reprolysin (M12B) family zinc metalloprotease
6	PF13574 Reprolysin_2	0.11	23.9	Metallo-peptidase family M12B Reprolysin-like
7	PF13582 Reprolysin_3	4.7e-08	45.0	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	0.031	25.5	Metallo-peptidase family M12B Reprolysin-like
9	PF13688 Reprolysin_5	6.8e-10	50.9	Metallo-peptidase family M12
10	PF19030 TSP1_ADAMTS	3.1e-19	80.3	Thrombospondin type 1 domain
11	PF19035 TSP1_CCN	0.27	22.9	CCN3 Nov like TSP1 domain
12	PF19028 TSP1_spondin	1.8e-05	36.3	Spondin-like TSP1 domain
13	PF00090 TSP_1	1.3e-10	52.6	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284984

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.981	Aggrecan core protein
2	9606.ENSP00000260356	0.934	Thrombospondin-1
3	9606.ENSP00000369921	0.931	ADAMTS-like protein 1
4	9606.ENSP00000355751	0.930	Thrombospondin-2
5	9606.ENSP00000286744	0.927	ADAMTS-like protein 3
6	9606.ENSP00000247153	0.925	Properdin
7	9606.ENSP00000286657	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 3
8	9606.ENSP00000422554	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 12
9	9606.ENSP00000339613	0.919	GDP-fucose protein O-fucosyltransferase 2
10	9606.ENSP00000347484	0.919	Thrombospondin type-1 domain-containing protein 4
11	9606.ENSP00000373472	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 7
12	9606.ENSP00000274487	0.918	ADAM metallopeptidase with thrombospondin type 1 motif 19
13	9606.ENSP00000284987	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 5
14	9606.ENSP00000358035	0.918	ADAMTS-like protein 4
15	9606.ENSP00000460236	0.918	Spondin-1
16	9606.ENSP00000251582	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 2
17	9606.ENSP00000343002	0.917	Beta-1,3-glucosyltransferase
18	9606.ENSP00000346478	0.917	ADAMTS-like protein 2
19	9606.ENSP00000360997	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 13
20	9606.ENSP00000362304	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004222	1.000	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0032502	0.969	developmental process
GO:0032501	0.963	multicellular organismal process
GO:0048856	0.963	anatomical structure development
GO:0050789	0.959	regulation of biological process
GO:0050794	0.906	regulation of cellular process
GO:0050896	0.901	response to stimulus
GO:0007275	0.835	multicellular organism development
GO:0048518	0.805	positive regulation of biological process
GO:0048519	0.772	negative regulation of biological process
GO:0048522	0.745	positive regulation of cellular process
GO:0042221	0.727	response to chemical
GO:0048523	0.723	negative regulation of cellular process
GO:0051239	0.701	regulation of multicellular organismal process
GO:0048513	0.693	animal organ development
GO:0051716	0.689	cellular response to stimulus
GO:0008152	0.669	metabolic process
GO:0010033	0.651	response to organic substance
GO:0044238	0.644	primary metabolic process
GO:0042127	0.637	regulation of cell population proliferation
GO:0071704	0.633	organic substance metabolic process
GO:0009653	0.624	anatomical structure morphogenesis
GO:0006807	0.612	nitrogen compound metabolic process
GO:0050793	0.603	regulation of developmental process
GO:0007154	0.600	cell communication
GO:0009719	0.574	response to endogenous stimulus
GO:0043170	0.571	macromolecule metabolic process
GO:1901564	0.554	organonitrogen compound metabolic process
GO:0019538	0.542	protein metabolic process
GO:0009605	0.534	response to external stimulus
GO:0071840	0.497	cellular component organization or biogenesis
GO:0022414	0.485	reproductive process
GO:0030334	0.460	regulation of cell migration
GO:0016043	0.444	cellular component organization
GO:0051241	0.380	negative regulation of multicellular organismal process
GO:0048583	0.347	regulation of response to stimulus
GO:0008284	0.328	positive regulation of cell population proliferation
GO:0048731	0.319	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0043227	0.839	membrane-bounded organelle
GO:0005576	0.828	extracellular region
GO:0012505	0.827	endomembrane system
GO:0043231	0.813	intracellular membrane-bounded organelle
GO:0005737	0.759	cytoplasm
GO:0005615	0.527	extracellular space
GO:0070013	0.407	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]