StarFunc result for job id Q9UHJ6

User Input

>input (478 residues)
MAARPITLGIDLGTTSVKAALLRAAPDDPSGFAVLASCARAARAEAAVESAVAGPQGREQ
DVSRILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRA
VSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHD
YVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRT
SHMWFEIPKGTQVGVALGDLQASVYSCMAQRTDAVLNISTSVQLAASMPSGFQPAQTPDP
TAPVAYFPYFNRTYLGVAASLNGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAVQ
QRDTHLTITPTVLGERHLPDQLASVTRISSSDLSLGHVTRALCRGIVQNLHSMLPIQQLQ
DWGVERVMGSGSALSRNDVLKQEVQRAFPLPMSFGQDVDAAVGAALVMLRRHLNQKES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHJ6	1.000	1.000	0.000	478	1.000	1.000	Q9UHJ6.pdb.gz	SHPK_HUMAN Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=4
2	AFDB:Q9D5J6	0.988	0.992	6.504E-96	476	0.870	0.874	Q9D5J6.pdb.gz	SHPK_MOUSE Sedoheptulokinase OS=Mus musculus OX=10090 GN=Shpk PE=1 SV=1
3	AFDB:Q0VDQ2	0.730	0.641	7.985E-26	549	0.184	0.160	Q0VDQ2.pdb.gz	Q0VDQ2_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
4	AFDB:P32189	0.671	0.583	9.392E-25	559	0.197	0.168	P32189.pdb.gz	GLPK_HUMAN Glycerol kinase OS=Homo sapiens OX=9606 GN=GK PE=1 SV=3
5	AFDB:Q14410	0.688	0.602	9.959E-25	553	0.186	0.161	Q14410.pdb.gz	GLPK2_HUMAN Glycerol kinase 2 OS=Homo sapiens OX=9606 GN=GK2 PE=1 SV=2
6	AFDB:Q9W0U0	0.730	0.656	9.959E-25	538	0.184	0.164	Q9W0U0.pdb.gz	Q9W0U0_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
7	AFDB:Q9VZJ8	0.721	0.637	1.120E-24	548	0.184	0.161	Q9VZJ8.pdb.gz	Q9VZJ8_DROME RH40737p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11594 PE=1 SV=1
8	AFDB:P09099	0.743	0.735	1.336E-24	484	0.207	0.205	P09099.pdb.gz	XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) OX=83333 GN=xylB PE=1 SV=1
9	AFDB:Q2YIQ1	0.801	0.741	1.593E-24	520	0.165	0.152	Q2YIQ1.pdb.gz	ERYA_BRUA2 Erythritol kinase OS=Brucella abortus (strain 2308) OX=359391 GN=eryA PE=1 SV=2
10	AFDB:P37677	0.729	0.702	1.689E-24	498	0.174	0.167	P37677.pdb.gz	LYXK_ECOLI L-xylulose/3-keto-L-gulonate kinase OS=Escherichia coli (strain K12) OX=83333 GN=lyx PE=1 SV=1
11	PDB:2itmA	0.716	0.718	3.943E-23	476	0.207	0.208	2itmA.pdb.gz	Structural and kinetic studies of induced fit in xylulose kinase from Escherichia coli.
12	PDB:1bu6Y	0.636	0.613	2.432E-22	499	0.159	0.152	1bu6Y.pdb.gz	Glycerol kinase from Escherichia coli and an Ala65-->Thr mutant: the crystal structures reveal conformational changes with implications for allosteric regulation.
13	PDB:5htvA	0.713	0.795	1.568E-20	424	0.184	0.208	5htvA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
14	PDB:5ya0A	0.666	0.664	3.567E-20	480	0.163	0.163	5ya0A.pdb.gz
15	PDB:5huxA	0.688	0.759	3.782E-20	429	0.182	0.203	5huxA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
16	PDB:4bc2A	0.738	0.674	2.950E-19	528	0.167	0.152	4bc2A.pdb.gz	Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
17	PDB:2cgjA	0.609	0.608	8.630E-16	479	0.165	0.165	2cgjA.pdb.gz	Structure and Reaction Mechanism of L-Rhamnulose Kinase from Escherichia Coli.
18	PDB:4a2bA	0.344	0.409	1.889E-8	386	0.109	0.135	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments
19	PDB:7q6dA	0.376	0.451	3.820E-8	383	0.115	0.144	7q6dA.pdb.gz	Bacterial divisome protein FtsA forms curved antiparallel double filaments when binding to FtsN.
20	PDB:3wquB	0.347	0.423	2.095E-7	371	0.094	0.121	3wquB.pdb.gz	Crystal structure of FtsA from Staphylococcus aureus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D5J6	0.0	860	476	0.870	0.874	SHPK_MOUSE Sedoheptulokinase OS=Mus musculus OX=10090 GN=Shpk PE=1 SV=1
2	Q9UHJ6	0.0	980	478	0.998	0.998	SHPK_HUMAN Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=4
3	P09099	4.11e-10	64.3	484	0.121	0.120	XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) OX=83333 GN=xylB PE=1 SV=1
4	Q9W0U0	1.01e-08	60.1	538	0.134	0.119	Q9W0U0_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
5	Q9M8L4	2.46e-06	52.4	522	0.128	0.117	GLPK_ARATH Glycerol kinase OS=Arabidopsis thaliana OX=3702 GN=GLPK PE=1 SV=1
6	Q9W095	3.28e-06	52.0	576	0.123	0.102	Q9W095_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=2
7	Q961K9	3.61e-06	52.0	576	0.123	0.102	Q961K9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=1
8	Q63060	5.57e-05	48.1	524	0.119	0.109	GLPK_RAT Glycerol kinase OS=Rattus norvegicus OX=10116 GN=Gk PE=2 SV=1
9	O51257	6.20e-05	47.8	501	0.211	0.202	GLPK_BORBU Glycerol kinase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=glpK PE=3 SV=1
10	Q64516	8.12e-05	47.4	559	0.109	0.093	GLPK_MOUSE Glycerol kinase OS=Mus musculus OX=10090 GN=Gk PE=1 SV=2
11	Q8IGQ5	1.98e-04	46.2	474	0.098	0.099	Q8IGQ5_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=2 SV=1
12	Q8IRJ9	1.98e-04	46.2	474	0.098	0.099	Q8IRJ9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
13	P32189	2.98e-04	45.8	559	0.121	0.104	GLPK_HUMAN Glycerol kinase OS=Homo sapiens OX=9606 GN=GK PE=1 SV=3
14	Q0VDQ2	4.30e-04	45.1	549	0.111	0.097	Q0VDQ2_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
15	Q9WU64	4.45e-04	45.1	549	0.111	0.097	Q9WU64_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
16	Q8C635	4.69e-04	45.1	549	0.111	0.097	Q8C635_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=1 SV=1
17	Q14410	7.13e-04	44.3	553	0.113	0.098	GLPK2_HUMAN Glycerol kinase 2 OS=Homo sapiens OX=9606 GN=GK2 PE=1 SV=2
18	Q9WU65	0.001	43.9	554	0.111	0.096	GLPK2_MOUSE Glycerol kinase 2 OS=Mus musculus OX=10090 GN=Gk2 PE=1 SV=1
19	P32190	0.88	34.7	709	0.073	0.049	GLPK_YEAST Glycerol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUT1 PE=1 SV=1
20	P0A6F3	2.3	33.1	502	0.134	0.127	GLPK_ECOLI Glycerol kinase OS=Escherichia coli (strain K12) OX=83333 GN=glpK PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01869 BcrAD_BadFG	5.4e+02	11.5	BadF/BadG/BcrA/BcrD ATPase family
2	PF18007 DUF5593	1.4e+02	14.5	Domain of unknown function (DUF5593)
3	PF00370 FGGY_N	6.3e-16	70.3	FGGY family of carbohydrate kinases, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371294	0.913	Cystinosin
2	9606.ENSP00000360262	0.817	FGGY carbohydrate kinase domain containing
3	9606.ENSP00000263080	0.778	Aspartoacylase
4	9606.ENSP00000430338	0.716	Integrator complex subunit 8
5	9606.ENSP00000229266	0.708	Cholinephosphotransferase 1
6	9606.ENSP00000440915	0.705	Mitochondrial ribonuclease P catalytic subunit
7	9606.ENSP00000323313	0.689	Protein disulfide-isomerase A5
8	9606.ENSP00000403396	0.637	Hyccin
9	9606.ENSP00000368164	0.634	DNA helicase MCM8
10	9606.ENSP00000263187	0.613	MutS protein homolog 4
11	9606.ENSP00000432472	0.607	Protein BRICK1
12	9606.ENSP00000459580	0.603	Spermatogenesis-associated protein 22
13	9606.ENSP00000350719	0.577	Nesprin-2
14	9606.ENSP00000459962	0.565	Transient receptor potential cation channel, subfamily V, member 1
15	9606.ENSP00000461007	0.565	Transient receptor potential cation channel subfamily V member 1
16	9606.ENSP00000296422	0.557	Sodium/hydrogen exchanger 9B1
17	9606.ENSP00000332449	0.550	Cysteine-rich protein 1
18	9606.ENSP00000424328	0.540	Mitochondrial ribosomal protein S30
19	9606.ENSP00000418695	0.537	Proteasome 26S subunit, non-ATPase 6
20	9606.ENSP00000308610	0.529	Glycerol-3-phosphate dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050277	1.000	sedoheptulokinase activity
GO:0005488	0.538	binding
GO:0005515	0.468	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.990	primary metabolic process
GO:0019637	0.986	organophosphate metabolic process
GO:0072521	0.986	purine-containing compound metabolic process
GO:0009117	0.981	nucleotide metabolic process
GO:0006163	0.970	purine nucleotide metabolic process
GO:0071216	0.968	cellular response to biotic stimulus
GO:0002237	0.965	response to molecule of bacterial origin
GO:0051156	0.963	glucose 6-phosphate metabolic process
GO:0046496	0.961	nicotinamide nucleotide metabolic process
GO:0016310	0.953	phosphorylation
GO:0006091	0.941	generation of precursor metabolites and energy
GO:0005975	0.940	carbohydrate metabolic process
GO:0071219	0.923	cellular response to molecule of bacterial origin
GO:0032496	0.917	response to lipopolysaccharide
GO:0006739	0.905	NADP metabolic process
GO:0071396	0.904	cellular response to lipid
GO:1901701	0.902	cellular response to oxygen-containing compound
GO:0071222	0.892	cellular response to lipopolysaccharide
GO:0006098	0.880	pentose-phosphate shunt
GO:0065007	0.355	biological regulation
GO:0050789	0.348	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005829	0.952	cytosol
GO:0016020	0.536	membrane
GO:0070013	0.531	intracellular organelle lumen
GO:0005634	0.445	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23844	1.000	ATP + sedoheptulose = ADP + D-sedoheptulose 7-phosphate + H(+)
EC:2.7.1.14	1.000	sedoheptulokinase.

[back to server]