StarFunc result for job id Q9UHL9

User Input

>input (959 residues)
MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNAEVACVAVHDE
SAFVVGTEKGRMFLNARKELQSDFLRFCRGPPWKDPEAEHPKKVQRGEGGGRSLPRSSLE
HGSDVYLLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAE
YDPKALMAILEHSHRIRFKLKRPLEDGGRDSKALVELNGVSLIPKGSRDCGLHGQAPKVP
PQDLPPTATSSSMASFLYSTALPNHAIRELKQEAPSCPLAPSDLGLSRPMPEPKATGAQD
FSDCCGQKPTGPGGPLIQNVHASKRILFSIVHDKSEKWDAFIKETEDINTLRECVQILFN
SRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLKRILEERHSIH
FIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDC
GPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD
KGLSEDARPEERPVEDSHGDVIRPLRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEE
LFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIKRPELLTEGVKEPIMDSQGTASS
LGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEA
LGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRP
FQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEV
TGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKVPAKDSSIPKR
KRKRVSEGNSVSSSSSSSSSSSSNPDSVASANQISLVQWPMYMVDYAGLNVQLPGPLNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PFE2	0.281	0.281	0.000	960	0.965	0.964	E9PFE2.pdb.gz	E9PFE2_HUMAN GTF2I repeat domain containing 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
2	AFDB:Q9JI57	0.280	0.248	0.000	1104	0.851	0.739	Q9JI57.pdb.gz	GT2D1_MOUSE General transcription factor II-I repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gtf2ird1 PE=2 SV=2
3	AFDB:B7ZQJ9	0.283	0.275	5.104E-100	993	0.617	0.596	B7ZQJ9.pdb.gz	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1
4	AFDB:Q17381	0.037	0.065	4.006E-2	506	0.062	0.117	Q17381.pdb.gz	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
5	AFDB:A2BGM5	0.040	0.064	6.922E-2	550	0.081	0.142	A2BGM5.pdb.gz	FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio OX=7955 GN=foxn4 PE=1 SV=1
6	AFDB:Q800Q5	0.053	0.066	1.335E-1	551	0.081	0.142	Q800Q5.pdb.gz	T7L1B_DANRE Transcription factor 7-like 1-B OS=Danio rerio OX=7955 GN=tcf7l1b PE=2 SV=1
7	AFDB:Q91904	0.046	0.092	2.067E-1	370	0.051	0.132	Q91904.pdb.gz	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
8	AFDB:Q7T2N8	0.043	0.077	2.573E-1	419	0.063	0.143	Q7T2N8.pdb.gz
9	AFDB:Q96PV6	0.035	0.041	2.717E-1	800	0.087	0.104	Q96PV6.pdb.gz	LENG8_HUMAN Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3
10	AFDB:Q7K3L1	0.042	0.043	3.572E-1	921	0.141	0.147	Q7K3L1.pdb.gz	MARS_DROME Guanylate kinase-associated protein mars OS=Drosophila melanogaster OX=7227 GN=mars PE=1 SV=1
11	PDB:6qw65X	0.037	0.057	8.946E-1	583	0.039	0.063	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:7db7B	0.044	0.053	2.671	836	0.033	0.038	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
13	PDB:6f40W	0.033	0.117	3.325	218	0.018	0.078	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
14	PDB:4v8mBY	0.030	0.139	4.370	100	0.010	0.100	4v8mBY.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:5f0gA	0.039	0.149	4.370	207	0.018	0.082	5f0gA.pdb.gz
16	PDB:3jb9M	0.033	0.114	4.616	207	0.021	0.097	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:3zqqC	0.028	0.102	4.616	134	0.014	0.097	3zqqC.pdb.gz
18	PDB:4o9yA	0.026	0.011	5.150	2490	0.019	0.007	4o9yA.pdb.gz
19	PDB:5j0nF	0.050	0.098	5.745	356	0.019	0.051	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
20	PDB:6gejS	0.036	0.098	6.068	208	0.016	0.072	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZQJ9	0.0	1108	993	0.624	0.602	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1
2	E9PFE2	0.0	1863	960	0.961	0.960	E9PFE2_HUMAN GTF2I repeat domain containing 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
3	Q9JI57	0.0	1575	1104	0.808	0.702	GT2D1_MOUSE General transcription factor II-I repeat domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gtf2ird1 PE=2 SV=2
4	Q9UHL9	0.0	1954	959	1.000	1.000	GT2D1_HUMAN General transcription factor II-I repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1 PE=1 SV=1
5	X5D2J9	3.35e-111	367	957	0.308	0.308	X5D2J9_HUMAN General transcription factor IIi isoform D (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
6	X5DNP5	2.50e-110	365	978	0.311	0.305	X5DNP5_HUMAN General transcription factor IIi isoform B (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
7	X5D939	2.35e-109	363	977	0.306	0.300	X5D939_HUMAN General transcription factor IIi isoform C (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
8	P78347	7.90e-109	362	998	0.308	0.296	GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2
9	X5DR09	7.90e-109	362	998	0.308	0.296	X5DR09_HUMAN General transcription factor IIi isoform A (Fragment) OS=Homo sapiens OX=9606 GN=GTF2I PE=2 SV=1
10	A0A494C1K3	1.12e-107	362	1159	0.312	0.258	A0A494C1K3_HUMAN General transcription factor IIi OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=1
11	Q9ESZ8	5.35e-69	251	998	0.203	0.195	GTF2I_MOUSE General transcription factor II-I OS=Mus musculus OX=10090 GN=Gtf2i PE=1 SV=3
12	Q5U2Y1	3.60e-68	248	979	0.200	0.196	GTF2I_RAT General transcription factor II-I OS=Rattus norvegicus OX=10116 GN=Gtf2i PE=1 SV=2
13	Q99NI3	3.16e-46	182	936	0.145	0.149	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
14	Q86UP8	6.84e-46	181	949	0.143	0.144	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
15	Q6EKJ0	7.21e-46	181	949	0.143	0.144	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
16	A0A494C1N8	1.27e-45	181	1116	0.143	0.123	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
17	A0A494C0I1	1.49e-45	180	1111	0.143	0.123	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
18	F4IAF6	2.8	34.3	1003	0.044	0.042	F4IAF6_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g05960 PE=1 SV=1
19	P0CE43	2.8	34.3	599	0.021	0.033	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
20	A0A0R4IBK5	7.8	33.1	5209	0.026	0.005	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02946 GTF2I	4.2e-145	483.6	GTF2I-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032994

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000032997	0.838	Uncharacterized protein
2	9598.ENSPTRP00000004326	0.824	cGMP-dependent protein kinase
3	9598.ENSPTRP00000027855	0.814	cGMP-dependent protein kinase
4	9598.ENSPTRP00000018490	0.746	Rhophilin, Rho GTPase binding protein 2
5	9598.ENSPTRP00000016430	0.709	Uncharacterized protein
6	9598.ENSPTRP00000032986	0.698	Replication factor C (Activator 1) 2, 40kDa
7	9598.ENSPTRP00000032990	0.697	CAP-GLY domain containing linker protein 2
8	9598.ENSPTRP00000021163	0.686	Uncharacterized protein
9	9598.ENSPTRP00000032930	0.671	Bromodomain adjacent to zinc finger domain, 1B
10	9598.ENSPTRP00000006102	0.669	Uncharacterized protein
11	9598.ENSPTRP00000027419	0.669	Uncharacterized protein
12	9598.ENSPTRP00000037451	0.666	Uncharacterized protein
13	9598.ENSPTRP00000021016	0.665	Uncharacterized protein
14	9598.ENSPTRP00000010505	0.663	Uncharacterized protein
15	9598.ENSPTRP00000001712	0.658	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
16	9598.ENSPTRP00000029740	0.656	Phosphodiesterase 6C, cGMP-specific, cone, alpha prime
17	9598.ENSPTRP00000011226	0.618	Uncharacterized protein
18	9598.ENSPTRP00000053678	0.605	Uncharacterized protein
19	9598.ENSPTRP00000032971	0.596	LIM domain kinase 1
20	9598.ENSPTRP00000032925	0.590	NOP2/Sun domain family, member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0001217	0.820	DNA-binding transcription repressor activity
GO:0000977	0.804	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.719	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.653	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048519	0.984	negative regulation of biological process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0048523	0.967	negative regulation of cellular process
GO:0051172	0.923	negative regulation of nitrogen compound metabolic process
GO:0006357	0.920	regulation of transcription by RNA polymerase II
GO:0045934	0.856	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.850	negative regulation of macromolecule metabolic process
GO:0031327	0.765	negative regulation of cellular biosynthetic process
GO:1903507	0.757	negative regulation of nucleic acid-templated transcription
GO:0045892	0.754	negative regulation of DNA-templated transcription
GO:0048583	0.430	regulation of response to stimulus
GO:0000122	0.386	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.976	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]