StarFunc result for job id Q9UHN6

User Input

>input (1383 residues)
MYATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATF
AFSPEEQQAQRESQKQKRHKNTFICFAITSFSFFIALAIILGISSKYAPDENCPDQNPRL
RNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYIL
IQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASW
TLLARTLNSSGLPFGSYTFEKDFSRGLNVRVIDQDTAKILESERFDTHEYRNESRRLQEF
LRFQDPGRIVAIAVGDSAAKSLLQGTIQMIQERLGSELIQGLGYRQAWALVGVIDGGSTS
CNESVRNYENHSSGGKALAQREFYTVDGQKFSVTAYSEWIEGVSLSGFRVEVVDGVKLNL
LDDVSSWKPGDQIVVASTDYSMYQAEEFTLLPCSECSHFQVKVKETPQFLHMGEIIDGVD
MRAEVGILTRNIVIQGEVEDSCYAENQCQFFDYDTFGGHIMIMKNFTSVHLSYVELKHMG
QQQMGRYPVHFHLCGDVDYKGGYRHATFVDGLSIHHSFSRCITVHGTNGLLIKDTIGFDT
LGHCFFLEDGIEQRNTLFHNLGLLTKPGTLLPTDRNNSMCTTMRDKVFGNYIPVPATDCM
AVSTFWIAHPNNNLINNAAAGSQDAGIWYLFHKEPTGESSGLQLLAKPELTPLGIFYNNR
VHSNFKAGLFIDKGVKTTNSSAADPREYLCLDNSARFRPHQDANPEKPRVAALIDRLIAF
KNNDNGAWVRGGDIIVQNSAFADNGIGLTFASDGSFPSDEGSSQEVSESLFVGESRNYGF
QGGQNKYVGTGGIDQKPRTLPRNRTFPIRGFQIYDGPIHLTRSTFKKYVPTPDRYSSAIG
FLMKNSWQITPRNNISLVKFGPHVSLNVFFGKPGPWFEDCEMDGDKNSIFHDIDGSVTGY
KDAYVGRMDNYLIRHPSCVNVSKWNAVICSGTYAQVYVQTWSTQNLSMTITRDEYPSNPM
VLRGINQKAAFPQYQPVVMLEKGYTIHWNGPAPRTTFLYLVNFNKNDWIRVGLCYPSNTS
FQVTFGYLQRQNGSLSKIEEYEPVHSLEELQRKQSERKFYFDSSTGLLFLYLKAKSHRHG
HSYCSSQGCERVKIQAATDSKDISNCMAKAYPQYYRKPSVVKRMPAMLTGLCQGCGTRQV
VFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGTDFTFRSAGVLLLVVDPCSVPFRLT
EKTVFPLADVSRIEEYLKTGIPPRSIVLLSTRGEIKQLNISHLLVPLGLAKPAHLYDKGS
TIFLGFSGNFKPSWTKLFTSPAGQGLGVLEQFIPLQLDEYGCPRATTVRRRDLELLKQAS
KAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KPQ7	0.936	0.939	0.000	1378	0.573	0.575	A3KPQ7.pdb.gz	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
2	AFDB:Q8BI06	0.699	0.710	0.000	1361	0.418	0.425	Q8BI06.pdb.gz	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
3	AFDB:Q9UHN6	1.000	1.000	0.000	1383	1.000	1.000	Q9UHN6.pdb.gz	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
4	AFDB:Q557B8	0.483	0.593	2.995E-36	1106	0.145	0.181	Q557B8.pdb.gz	COMF_DICDI Communication mutant protein F OS=Dictyostelium discoideum OX=44689 GN=comF-1 PE=3 SV=1
5	PDB:2yopC	0.069	0.493	4.948E-4	181	0.017	0.133	2yopC.pdb.gz
6	PDB:5iz5B	0.042	0.067	1.461E-2	746	0.024	0.044	5iz5B.pdb.gz
7	PDB:5iz5A	0.043	0.069	9.255E-2	757	0.020	0.037	5iz5A.pdb.gz
8	PDB:4uflA	0.051	0.082	1.259E-1	641	0.022	0.048	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
9	AFDB:E1BJB4	0.043	0.046	2.711E-1	1270	0.027	0.030	E1BJB4.pdb.gz	E1BJB4_BOVIN RPGRIP1 like OS=Bos taurus OX=9913 GN=RPGRIP1L PE=1 SV=3
10	PDB:2flhB	0.048	0.237	2.777E-1	153	0.009	0.078	2flhB.pdb.gz	Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.
11	PDB:4r3oK	0.055	0.258	2.777E-1	199	0.017	0.121	4r3oK.pdb.gz
12	PDB:5izrC	0.033	0.057	3.169E-1	659	0.014	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:5iv5BG	0.028	0.123	3.311E-1	192	0.017	0.120	5iv5BG.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
14	PDB:5ixcA	0.032	0.056	4.125E-1	684	0.015	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:1ifvA	0.048	0.235	4.311E-1	155	0.014	0.129	1ifvA.pdb.gz
16	AFDB:O13297	0.030	0.061	7.450E-1	549	0.030	0.077	O13297.pdb.gz	CET1_YEAST mRNA-capping enzyme subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CET1 PE=1 SV=2
17	AFDB:O53445	0.038	0.098	9.281E-1	293	0.033	0.154	O53445.pdb.gz	O53445_MYCTU Probable membrane glycine and proline rich protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1097c PE=1 SV=1
18	AFDB:Q52KB6	0.042	0.028	9.281E-1	2323	0.030	0.018	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
19	AFDB:M9PDD2	0.043	0.069	1.795	655	0.021	0.044	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
20	AFDB:Q09459	0.034	0.035	2.336	1322	0.026	0.027	Q09459.pdb.gz	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KPQ7	0.0	1644	1378	0.578	0.581	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
2	B4E1B9	0.0	785	376	0.272	1.000	B4E1B9_HUMAN Cell migration inducing hyaluronidase 2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
3	Q8BI06	0.0	903	1361	0.329	0.334	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
4	Q8WUJ3	0.0	905	1361	0.329	0.334	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
5	Q9UHN6	0.0	2887	1383	1.000	1.000	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
6	Q80ZA4	5.08e-41	169	4249	0.095	0.031	PKHL1_MOUSE Fibrocystin-L OS=Mus musculus OX=10090 GN=Pkhd1l1 PE=1 SV=1
7	Q86WI1	1.26e-40	167	4243	0.093	0.030	PKHL1_HUMAN Fibrocystin-L OS=Homo sapiens OX=9606 GN=PKHD1L1 PE=2 SV=2
8	Q557B8	5.91e-25	115	1106	0.137	0.172	COMF_DICDI Communication mutant protein F OS=Dictyostelium discoideum OX=44689 GN=comF-1 PE=3 SV=1
9	E2RK30	1.58e-11	72.0	4074	0.046	0.016	PKHD1_CANLF Fibrocystin OS=Canis lupus familiaris OX=9615 GN=PKHD1 PE=3 SV=2
10	P08F94	1.31e-09	65.9	4074	0.074	0.025	PKHD1_HUMAN Fibrocystin OS=Homo sapiens OX=9606 GN=PKHD1 PE=1 SV=1
11	E9PZ36	3.70e-09	64.3	4059	0.031	0.011	PKHD1_MOUSE Fibrocystin OS=Mus musculus OX=10090 GN=Pkhd1 PE=1 SV=1
12	Q6T3A5	3.74e-09	64.3	4060	0.031	0.011	Q6T3A5_MOUSE PKHD1 OS=Mus musculus OX=10090 GN=Pkhd1 PE=2 SV=1
13	A0A0G2K2W1	4.49e-09	63.9	4052	0.095	0.033	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
14	Q8WZA1	5.11e-05	50.1	660	0.021	0.044	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
15	Q91X88	5.56e-05	50.1	660	0.021	0.044	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
16	P97805	6.38e-04	45.1	223	0.021	0.130	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
17	Q9D309	8.27e-04	45.1	235	0.022	0.128	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
18	Q96BQ1	0.002	43.5	224	0.018	0.112	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
19	P98173	0.003	43.1	230	0.018	0.109	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2
20	Q92520	0.003	43.5	227	0.020	0.119	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13229 Beta_helix	82	14.5	Right handed beta helix region
2	PF10162 G8	3.1e-26	103.1	G8 domain
3	PF15711 ILEI	5.9e-30	114.9	Interleukin-like EMT inducer

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274711	0.900	Leucine-rich repeat transmembrane neuronal protein 2
2	9606.ENSP00000258034	0.694	Trace amine-associated receptor 5
3	9606.ENSP00000378294	0.670	Nucleotide exchange factor SIL1
4	9606.ENSP00000345629	0.619	Mitogen-activated protein kinase kinase kinase 15
5	9606.ENSP00000401853	0.616	Hyaluronidase-2
6	9606.ENSP00000378394	0.576	Prosaposin
7	9606.ENSP00000366223	0.519	Uncharacterized protein C9orf57
8	9606.ENSP00000345849	0.503	Hyaluronidase PH-20
9	9606.ENSP00000381102	0.500	Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004415	1.000	hyalurononglucosaminidase activity
GO:0005509	0.998	calcium ion binding
GO:0045296	0.997	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.932	metabolic process
GO:0071704	0.916	organic substance metabolic process
GO:1903510	0.827	mucopolysaccharide metabolic process
GO:0065007	0.759	biological regulation
GO:0050789	0.748	regulation of biological process
GO:0006026	0.733	aminoglycan catabolic process
GO:0006027	0.707	glycosaminoglycan catabolic process
GO:0009987	0.660	cellular process
GO:0050794	0.589	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031981	0.998	nuclear lumen
GO:0005829	0.996	cytosol
GO:0005730	0.987	nucleolus
GO:0005576	0.904	extracellular region
GO:0031982	0.864	vesicle
GO:0005615	0.753	extracellular space
GO:1903561	0.697	extracellular vesicle
GO:0070062	0.656	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.35	1.000	hyaluronoglucosaminidase.

[back to server]