StarFunc result for job id Q9UHQ9

User Input

>input (305 residues)
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DB73	0.992	0.992	9.890E-65	305	0.918	0.918	Q9DB73.pdb.gz	NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus OX=10090 GN=Cyb5r1 PE=1 SV=1
2	AFDB:Q1MTC9	0.900	0.921	2.112E-53	298	0.580	0.594	Q1MTC9.pdb.gz
3	AFDB:P20070	0.903	0.915	2.084E-52	301	0.580	0.588	P20070.pdb.gz	NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus OX=10116 GN=Cyb5r3 PE=1 SV=2
4	AFDB:B5X1Q9	0.918	0.936	3.178E-52	299	0.567	0.579	B5X1Q9.pdb.gz	B5X1Q9_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
5	AFDB:P00387	0.918	0.930	1.196E-51	301	0.600	0.608	P00387.pdb.gz	NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3
6	AFDB:Q6BCY4	0.885	0.978	1.254E-50	276	0.525	0.580	Q6BCY4.pdb.gz	NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens OX=9606 GN=CYB5R2 PE=1 SV=1
7	AFDB:Q0P487	0.900	0.888	1.165E-49	309	0.554	0.547	Q0P487.pdb.gz	NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio OX=7955 GN=cyb5r2 PE=2 SV=2
8	AFDB:Q3KNK3	0.883	0.975	2.401E-49	276	0.518	0.572	Q3KNK3.pdb.gz	NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus OX=10090 GN=Cyb5r2 PE=2 SV=2
9	AFDB:Q9I7R1	0.882	0.859	3.887E-49	313	0.548	0.534	Q9I7R1.pdb.gz	Q9I7R1_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=2
10	PDB:5gv7A	0.878	0.984	1.221E-48	272	0.570	0.640	5gv7A.pdb.gz	Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
11	AFDB:X2JGK6	0.864	0.799	2.637E-47	330	0.541	0.500	X2JGK6.pdb.gz	X2JGK6_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
12	PDB:7romA	0.755	0.899	4.199E-32	255	0.331	0.396	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD
13	PDB:7xk3F	0.669	0.512	6.685E-17	408	0.187	0.140	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
14	PDB:1gvhA	0.675	0.530	1.554E-16	396	0.184	0.141	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
15	PDB:1cqxA	0.575	0.454	7.345E-15	403	0.210	0.159	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
16	PDB:1fdrA	0.636	0.780	8.286E-15	244	0.170	0.213	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
17	PDB:3crzA	0.604	0.702	1.513E-14	257	0.154	0.183	3crzA.pdb.gz	X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
18	PDB:1qfjA	0.622	0.819	1.230E-12	226	0.115	0.155	1qfjA.pdb.gz
19	PDB:1ep1B	0.556	0.640	1.876E-12	261	0.161	0.188	1ep1B.pdb.gz	Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
20	PDB:3lvbA	0.628	0.618	1.876E-12	311	0.174	0.170	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9DB73	0.0	554	305	0.918	0.918	NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus OX=10090 GN=Cyb5r1 PE=1 SV=1
2	Q9UHQ9	0.0	622	305	1.000	1.000	NB5R1_HUMAN NADH-cytochrome b5 reductase 1 OS=Homo sapiens OX=9606 GN=CYB5R1 PE=1 SV=1
3	Q6NYE6	3.26e-137	392	298	0.564	0.577	Q6NYE6_DANRE NADH-cytochrome b5 reductase OS=Danio rerio OX=7955 GN=fc32h03 PE=1 SV=1
4	B5X1Q9	8.89e-136	388	299	0.570	0.582	B5X1Q9_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
5	P20070	2.55e-133	382	301	0.570	0.578	NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus OX=10116 GN=Cyb5r3 PE=1 SV=2
6	P07514	1.39e-132	380	301	0.584	0.591	NB5R3_BOVIN NADH-cytochrome b5 reductase 3 OS=Bos taurus OX=9913 GN=CYB5R3 PE=1 SV=3
7	Q0X0E5	1.67e-132	380	301	0.580	0.588	NB5R3_CANLF NADH-cytochrome b5 reductase 3 OS=Canis lupus familiaris OX=9615 GN=CYB5R3 PE=1 SV=1
8	P83686	3.89e-132	378	272	0.570	0.640	NB5R3_PIG NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus scrofa OX=9823 GN=CYB5R3 PE=1 SV=1
9	B5XEF8	8.78e-132	378	294	0.567	0.588	B5XEF8_SALSA NADH-cytochrome b5 reductase OS=Salmo salar OX=8030 GN=NB5R3 PE=2 SV=1
10	Q9DCN2	1.64e-131	377	301	0.570	0.578	NB5R3_MOUSE NADH-cytochrome b5 reductase 3 OS=Mus musculus OX=10090 GN=Cyb5r3 PE=1 SV=3
11	P00387	5.91e-131	376	301	0.577	0.585	NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3
12	Q0P487	7.96e-122	353	309	0.554	0.547	NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio OX=7955 GN=cyb5r2 PE=2 SV=2
13	Q6BCY4	1.34e-121	351	276	0.525	0.580	NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens OX=9606 GN=CYB5R2 PE=1 SV=1
14	Q3KNK3	5.90e-120	347	276	0.518	0.572	NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus OX=10090 GN=Cyb5r2 PE=2 SV=2
15	Q4LDP7	3.10e-117	342	316	0.544	0.525	Q4LDP7_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
16	Q9I7R1	5.64e-117	341	313	0.544	0.530	Q9I7R1_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=2
17	Q0E8F5	9.56e-116	338	316	0.534	0.516	Q0E8F5_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
18	Q0E8F4	1.12e-115	338	313	0.534	0.521	Q0E8F4_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
19	X2JGK6	6.53e-112	328	330	0.534	0.494	X2JGK6_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1
20	E1JHY0	1.46e-90	272	263	0.439	0.510	E1JHY0_DROME NADH-cytochrome b5 reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5946 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00970 FAD_binding_6	8.2e-32	120.8	Oxidoreductase FAD-binding domain
2	PF08021 FAD_binding_9	1.9e+02	13.6	Siderophore-interacting FAD-binding domain
3	PF00175 NAD_binding_1	8.7e-31	118.2	Oxidoreductase NAD-binding domain
4	PF08030 NAD_binding_6	0.043	25.4	Ferric reductase NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333994	0.904	Hemoglobin subunit beta
2	9606.ENSP00000341625	0.826	Cytochrome b5
3	9606.ENSP00000308430	0.651	Cytochrome b5 type B
4	9606.ENSP00000419970	0.650	NADPH--cytochrome P450 reductase
5	9606.ENSP00000363205	0.607	Cysteine desulfurase, mitochondrial
6	9606.ENSP00000336721	0.534	La-related protein 1
7	9606.ENSP00000416515	0.533	NADPH:adrenodoxin oxidoreductase, mitochondrial
8	9606.ENSP00000371253	0.516	Trifunctional purine biosynthetic protein adenosine-3
9	9606.ENSP00000371594	0.513	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
10	9606.ENSP00000253458	0.512	Genetic suppressor element 1
11	9606.ENSP00000307786	0.510	Cytochrome c
12	9606.ENSP00000481045	0.510	Dual specificity testis-specific protein kinase 1
13	9606.ENSP00000452786	0.508	Integrin beta-3
14	9606.ENSP00000290583	0.501	CUGBP Elav-like family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016653	0.999	oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor
GO:0005515	0.996	protein binding
GO:1901363	0.880	heterocyclic compound binding
GO:0097159	0.877	organic cyclic compound binding
GO:0004128	0.861	cytochrome-b5 reductase activity, acting on NAD(P)H
GO:0043167	0.842	ion binding
GO:0050660	0.807	flavin adenine dinucleotide binding
GO:0071949	0.770	FAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019755	0.854	one-carbon compound transport
GO:0009987	0.820	cellular process
GO:0008152	0.812	metabolic process
GO:0044237	0.785	cellular metabolic process
GO:0015711	0.543	organic anion transport
GO:0006807	0.356	nitrogen compound metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0065007	0.304	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.991	endomembrane system
GO:0031090	0.988	organelle membrane
GO:0005739	0.986	mitochondrion
GO:0031982	0.964	vesicle
GO:0005576	0.953	extracellular region
GO:0005615	0.912	extracellular space
GO:0005783	0.794	endoplasmic reticulum
GO:1903561	0.707	extracellular vesicle
GO:0031410	0.703	cytoplasmic vesicle
GO:0070062	0.613	extracellular exosome
GO:0071944	0.557	cell periphery
GO:0070013	0.508	intracellular organelle lumen
GO:0098588	0.478	bounding membrane of organelle
GO:0005789	0.465	endoplasmic reticulum membrane
GO:0005740	0.433	mitochondrial envelope
GO:0030141	0.344	secretory granule
GO:0031966	0.328	mitochondrial membrane
GO:0005886	0.313	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.2.-	0.999	With a heme protein as acceptor.
RHEA:46680	0.861	2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+)
EC:1.6.2.2	0.861	cytochrome-b5 reductase.

[back to server]