StarFunc result for job id Q9UHR4

User Input

>input (511 residues)
MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGE
IATGSPVSTELGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLK
RYQTEHKNKLESLEKSQAELKKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIAD
GCKEALLEEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIM
NMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDM
FNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLS
FAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGT
AKPPFLSGENPFATVKLRPTVTNDRSAPIIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHR4	1.000	1.000	2.201E-70	511	1.000	1.000	Q9UHR4.pdb.gz	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
2	AFDB:Q6GMN2	0.560	0.537	2.323E-37	535	0.415	0.396	Q6GMN2.pdb.gz	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
3	AFDB:I3L4C2	0.454	0.420	2.458E-33	553	0.387	0.358	I3L4C2.pdb.gz	I3L4C2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
4	AFDB:Q6UXY1	0.418	0.404	9.828E-26	529	0.311	0.301	Q6UXY1.pdb.gz	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
5	AFDB:Q9C865	0.314	0.355	1.359E-13	439	0.115	0.134	Q9C865.pdb.gz	SH3P1_ARATH SH3 domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=SH3P1 PE=1 SV=1
6	AFDB:A0A0B4JCZ8	0.455	0.120	1.261E-11	2028	0.184	0.046	A0A0B4JCZ8.pdb.gz	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:Q6P9S0	0.426	0.310	1.717E-11	715	0.166	0.119	Q6P9S0.pdb.gz	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
8	AFDB:E1JGY9	0.453	0.254	2.004E-11	950	0.188	0.101	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	AFDB:A0A0B4JD47	0.437	0.238	3.185E-11	977	0.184	0.096	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
10	AFDB:A0A0B4K822	0.442	0.206	4.120E-11	1136	0.160	0.072	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
11	PDB:6ikoA	0.255	0.375	6.416E-5	303	0.067	0.112	6ikoA.pdb.gz
12	PDB:2dybA	0.111	0.187	4.094E-4	298	0.049	0.084	2dybA.pdb.gz
13	PDB:3hajA	0.232	0.359	2.612E-3	286	0.057	0.101	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
14	PDB:3ehqA	0.105	0.282	3.049E-3	182	0.020	0.055	3ehqA.pdb.gz
15	PDB:1k9aB	0.106	0.123	3.558E-3	441	0.023	0.027	1k9aB.pdb.gz
16	PDB:2lqnA	0.108	0.178	4.846E-3	303	0.033	0.056	2lqnA.pdb.gz
17	PDB:3qwyA	0.114	0.315	5.102E-3	170	0.037	0.112	3qwyA.pdb.gz
18	PDB:1griA	0.111	0.260	6.599E-3	211	0.027	0.066	1griA.pdb.gz
19	PDB:1k0xA	0.106	0.450	8.988E-3	108	0.022	0.102	1k0xA.pdb.gz
20	PDB:2eyzA	0.109	0.175	1.289E-2	304	0.037	0.062	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHR4	0.0	1060	511	1.000	1.000	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
2	Q8BKX1	5.58e-136	405	535	0.421	0.402	BAIP2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Mus musculus OX=10090 GN=Baiap2 PE=1 SV=2
3	Q6GMN2	7.80e-136	405	535	0.421	0.402	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
4	Q9UQB8	2.41e-135	404	552	0.427	0.395	BAIP2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
5	Q60437	2.50e-126	380	521	0.380	0.372	BAIP2_CRIGR Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Cricetulus griseus OX=10029 GN=BAIAP2 PE=1 SV=1
6	I3L4C2	5.51e-124	375	553	0.387	0.358	I3L4C2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
7	Q6UXY1	1.78e-67	228	529	0.337	0.325	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
8	B4DWA1	1.97e-61	207	375	0.235	0.320	B4DWA1_HUMAN BAR/IMD domain containing adaptor protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
9	Q80Y61	2.55e-58	203	522	0.249	0.243	BI2L2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Mus musculus OX=10090 GN=Baiap2l2 PE=1 SV=1
10	I3L3C6	3.22e-41	149	216	0.176	0.417	I3L3C6_HUMAN BAR/IMD domain containing adaptor protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
11	X2JCT5	2.60e-28	121	646	0.125	0.099	X2JCT5_DROME Insulin receptor substrate 53 kDa, isoform E OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
12	A8JNR2	2.91e-28	120	629	0.125	0.102	A8JNR2_DROME Insulin receptor substrate 53 kDa, isoform D OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
13	A8JNR3	3.03e-28	120	630	0.125	0.102	A8JNR3_DROME Insulin receptor substrate 53 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
14	Q8IQE6	3.52e-28	121	1076	0.125	0.059	Q8IQE6_DROME Insulin receptor substrate 53 kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
15	A0A0B4KEK0	6.60e-08	57.8	1362	0.090	0.034	A0A0B4KEK0_DROME Missing-in-metastasis, isoform N OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
16	A0A0B4KEE8	8.41e-08	57.8	1802	0.090	0.026	A0A0B4KEE8_DROME Missing-in-metastasis, isoform L OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
17	A0A0B4K7T1	8.67e-08	57.8	1868	0.090	0.025	A0A0B4K7T1_DROME Missing-in-metastasis, isoform J OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
18	A0A0B4JCZ8	9.63e-08	57.4	2028	0.090	0.023	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
19	A1Z6S0	1.08e-07	57.4	2027	0.090	0.023	A1Z6S0_DROME Missing-in-metastasis, isoform C OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=2
20	A0A0B4JCQ4	1.09e-07	57.4	2009	0.090	0.023	A0A0B4JCQ4_DROME Missing-in-metastasis, isoform G OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16746 BAR_3	0.18	22.9	BAR domain of APPL family
2	PF12022 COG2_C	8.7e+02	11.5	COG complex component, COG2, C-terminal
3	PF02601 Exonuc_VII_L	3.5e+02	12.2	Exonuclease VII, large subunit
4	PF03961 FapA	8.7e+02	10.9	Flagellar Assembly Protein A beta solenoid domain
5	PF08397 IMD	3.7e-61	217.9	IRSp53/MIM homology domain
6	PF04791 LMBR1	6.7e+02	10.5	LMBR1-like membrane protein
7	PF05478 Prominin	1.4e+02	11.9	Prominin
8	PF00018 SH3_1	0.084	23.8	SH3 domain
9	PF07653 SH3_2	0.00045	31.3	Variant SH3 domain
10	PF14604 SH3_9	9.7e-07	40.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000005260

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223023	0.970	Neural Wiskott-Aldrich syndrome protein
2	9606.ENSP00000281172	0.918	Epidermal growth factor receptor kinase substrate 8
3	9606.ENSP00000383118	0.803	Cell division control protein 42 homolog
4	9606.ENSP00000365891	0.740	Wiskott-Aldrich syndrome protein
5	9606.ENSP00000417273	0.729	Cytoplasmic protein NCK1
6	9606.ENSP00000316338	0.631	Brain-specific angiogenesis inhibitor 1-associated protein 2
7	9606.ENSP00000341171	0.624	MTSS1-like protein
8	9606.ENSP00000326550	0.616	Transforming acidic coiled-coil-containing protein 3
9	9606.ENSP00000258149	0.587	E3 ubiquitin-protein ligase Mdm2
10	9606.ENSP00000451828	0.577	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000376024	0.532	Sorting nexin-9
12	9606.ENSP00000321703	0.529	Transforming acidic coiled-coil-containing protein 1
13	9606.ENSP00000348602	0.523	Amphiphysin
14	9606.ENSP00000483313	0.512	Wiskott-Aldrich syndrome protein family member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070064	0.999	proline-rich region binding
GO:0045296	0.999	cadherin binding
GO:0098632	0.999	cell-cell adhesion mediator activity
GO:0098641	0.788	cadherin binding involved in cell-cell adhesion
GO:0042802	0.749	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.993	cellular component organization
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0048518	0.947	positive regulation of biological process
GO:0043254	0.941	regulation of protein-containing complex assembly
GO:0031334	0.928	positive regulation of protein-containing complex assembly
GO:0110053	0.927	regulation of actin filament organization
GO:0032273	0.924	positive regulation of protein polymerization
GO:0032535	0.916	regulation of cellular component size
GO:0008064	0.858	regulation of actin polymerization or depolymerization
GO:1902905	0.849	positive regulation of supramolecular fiber organization
GO:0051495	0.840	positive regulation of cytoskeleton organization
GO:0030833	0.813	regulation of actin filament polymerization
GO:0030838	0.767	positive regulation of actin filament polymerization
GO:2000249	0.644	regulation of actin cytoskeleton reorganization
GO:0044419	0.616	biological process involved in interspecies interaction between organisms
GO:0009605	0.615	response to external stimulus
GO:0009607	0.570	response to biotic stimulus
GO:0043207	0.416	response to external biotic stimulus
GO:0032501	0.345	multicellular organismal process
GO:0023052	0.322	signaling
GO:0007154	0.322	cell communication
GO:0051716	0.319	cellular response to stimulus
GO:0007165	0.306	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0005654	0.991	nucleoplasm
GO:0030054	0.984	cell junction
GO:0005856	0.984	cytoskeleton
GO:0031982	0.977	vesicle
GO:0005576	0.952	extracellular region
GO:0070062	0.854	extracellular exosome
GO:0070161	0.725	anchoring junction
GO:0005911	0.717	cell-cell junction
GO:0015629	0.678	actin cytoskeleton
GO:0005912	0.343	adherens junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]