StarFunc result for job id Q9UHR5

User Input

>input (308 residues)
MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDG
YEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIP
PEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTN
YPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTT
TTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVG
TIVKKAKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8R0	0.405	0.405	2.605E-40	308	1.000	1.000	A0A024R8R0.pdb.gz
2	AFDB:P70475	0.081	0.032	7.451E-1	1187	0.120	0.031	P70475.pdb.gz	MYT1L_RAT Myelin transcription factor 1-like protein OS=Rattus norvegicus OX=10116 GN=Myt1l PE=1 SV=3
3	AFDB:Q8N693	0.071	0.058	1.040	406	0.143	0.108	Q8N693.pdb.gz	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
4	AFDB:Q96IZ7	0.106	0.102	1.112	334	0.097	0.090	Q96IZ7.pdb.gz	RSRC1_HUMAN Serine/Arginine-related protein 53 OS=Homo sapiens OX=9606 GN=RSRC1 PE=1 SV=1
5	AFDB:Q57U40	0.093	0.049	1.189	739	0.146	0.061	Q57U40.pdb.gz	Q57U40_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.320 PE=4 SV=1
6	AFDB:Q5Z807	0.109	0.091	1.453	390	0.127	0.100	Q5Z807.pdb.gz	C3H46_ORYSJ Zinc finger CCCH domain-containing protein 46 OS=Oryza sativa subsp. japonica OX=39947 GN=LIC PE=1 SV=1
7	AFDB:Q80VH0	0.092	0.043	1.660	783	0.146	0.057	Q80VH0.pdb.gz	BANK1_MOUSE B-cell scaffold protein with ankyrin repeats OS=Mus musculus OX=10090 GN=Bank1 PE=1 SV=3
8	AFDB:D4AA63	0.088	0.048	1.897	638	0.123	0.060	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
9	AFDB:Q84T08	0.116	0.131	2.028	265	0.172	0.200	Q84T08.pdb.gz	BH089_ORYSJ Transcription factor BHLH089 OS=Oryza sativa subsp. japonica OX=39947 GN=BHLH089 PE=1 SV=1
10	AFDB:Q91616	0.081	0.072	2.028	352	0.156	0.136	Q91616.pdb.gz	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
11	PDB:3j6bP	0.067	0.095	4.275	207	0.068	0.101	3j6bP.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
12	PDB:6elzm	0.072	0.038	5.223	645	0.058	0.028	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
13	PDB:6mrjB	0.086	0.149	5.583	142	0.045	0.099	6mrjB.pdb.gz	Crystal structure of H.pylori NikR in complex with DNA
14	PDB:6wjv4	0.083	0.179	5.969	107	0.039	0.112	6wjv4.pdb.gz
15	PDB:6g2jA	0.082	0.166	6.381	115	0.058	0.157	6g2jA.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
16	PDB:7enas	0.105	0.266	6.381	81	0.039	0.148	7enas.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:5mrcNN	0.069	0.149	6.821	115	0.042	0.113	5mrcNN.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:6yxyBJ	0.080	0.084	6.821	293	0.045	0.048	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7rroE	0.087	0.101	6.821	255	0.036	0.043	7rroE.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:5xtcj	0.076	0.142	7.292	115	0.032	0.087	5xtcj.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QQJ0	0.0	575	325	0.942	0.892	J3QQJ0_HUMAN SAP30 binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SAP30BP PE=1 SV=1
2	Q9UHR5	0.0	628	308	1.000	1.000	S30BP_HUMAN SAP30-binding protein OS=Homo sapiens OX=9606 GN=SAP30BP PE=1 SV=1
3	J3KRR6	1.13e-78	236	109	0.354	1.000	J3KRR6_HUMAN SAP30 binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SAP30BP PE=1 SV=1
4	J3QLM2	2.30e-67	207	93	0.302	1.000	J3QLM2_HUMAN SAP30 binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SAP30BP PE=1 SV=1
5	Q10069	1.01e-07	52.8	146	0.120	0.253	MU151_SCHPO Meiotically up-regulated gene 151 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug151 PE=1 SV=1
6	Q3UTY6	0.087	37.0	1018	0.071	0.022	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
7	O94248	0.15	36.6	4717	0.101	0.007	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
8	A2AWL7	0.68	34.3	3003	0.075	0.008	MGAP_MOUSE MAX gene-associated protein OS=Mus musculus OX=10090 GN=Mga PE=2 SV=1
9	A0A669KB89	0.92	33.9	1658	0.084	0.016	A0A669KB89_HUMAN Scribble planar cell polarity protein OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
10	Q14160	0.92	33.9	1630	0.084	0.016	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07818 HCNGP	3.6e-30	115.8	HCNGP-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462116

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296504	0.936	Histone deacetylase complex subunit SAP30
2	9606.ENSP00000434359	0.901	Poly(U)-binding-splicing factor PUF60
3	9606.ENSP00000477527	0.901	Histone H2B type 1-O
4	9606.ENSP00000274764	0.900	Histone H2B type 1-A
5	9606.ENSP00000289316	0.900	Histone H2B type 1-D
6	9606.ENSP00000296417	0.900	Histone H2A.Z
7	9606.ENSP00000308405	0.900	Histone H2A.V
8	9606.ENSP00000328484	0.900	Histone H2A type 1-J
9	9606.ENSP00000332194	0.900	Histone H2A type 2-C
10	9606.ENSP00000341094	0.900	Histone H2A type 1-D
11	9606.ENSP00000349430	0.900	Histone H2B type 1-K
12	9606.ENSP00000358151	0.900	Histone H2B type 2-E
13	9606.ENSP00000366618	0.900	Histone H2B type 1-L
14	9606.ENSP00000367022	0.900	Histone H2A type 1-C
15	9606.ENSP00000434024	0.900	Histone H2AX
16	9606.ENSP00000438553	0.900	Histone H2A.J
17	9606.ENSP00000476136	0.900	Histone H2B type 1-J
18	9606.ENSP00000477907	0.900	Histone H2B type 1-M
19	9606.ENSP00000479169	0.900	Histone H2B type 1-H
20	9606.ENSP00000481622	0.900	Histone H2B type F-S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.332	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0080090	0.991	regulation of primary metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0051173	0.978	positive regulation of nitrogen compound metabolic process
GO:0044419	0.963	biological process involved in interspecies interaction between organisms
GO:0051246	0.956	regulation of protein metabolic process
GO:0050896	0.954	response to stimulus
GO:0051702	0.935	biological process involved in interaction with symbiont
GO:0031399	0.933	regulation of protein modification process
GO:0009615	0.920	response to virus
GO:0031056	0.917	regulation of histone modification
GO:0051851	0.901	modulation by host of symbiont process
GO:0090311	0.893	regulation of protein deacetylation
GO:0051247	0.874	positive regulation of protein metabolic process
GO:0031058	0.820	positive regulation of histone modification
GO:0050794	0.812	regulation of cellular process
GO:0009987	0.730	cellular process
GO:0031323	0.577	regulation of cellular metabolic process
GO:0010468	0.559	regulation of gene expression
GO:0019219	0.500	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.498	organic substance metabolic process
GO:0051252	0.472	regulation of RNA metabolic process
GO:0044238	0.440	primary metabolic process
GO:0031063	0.436	regulation of histone deacetylation
GO:0010556	0.429	regulation of macromolecule biosynthetic process
GO:0031326	0.429	regulation of cellular biosynthetic process
GO:0043170	0.424	macromolecule metabolic process
GO:0006807	0.420	nitrogen compound metabolic process
GO:0006355	0.417	regulation of DNA-templated transcription
GO:0044237	0.317	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045111	1.000	intermediate filament cytoskeleton
GO:0005654	1.000	nucleoplasm
GO:0032991	0.630	protein-containing complex
GO:0005737	0.543	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]