StarFunc result for job id Q9UHV7

User Input

>input (2174 residues)
MSASFVPNGASLEDCHCNLFCLADLTGIKWKKYVWQGPTSAPILFPVTEEDPILSSFSRC
LKADVLGVWRRDQRPGRRELWIFWWGEDPSFADLIHHDLSEEEDGVWENGLSYECRTLLF
KAVHNLLERCLMNRNFVRIGKWFVKPYEKDEKPINKSEHLSCSFTFFLHGDSNVCTSVEI
NQHQPVYLLSEEHITLAQQSNSPFQVILCPFGLNGTLTGQAFKMSDSATKKLIGEWKQFY
PISCCLKEMSEEKQEDMDWEDDSLAAVEVLVAGVRMIYPACFVLVPQSDIPTPSPVGSTH
CSSSCLGVHQVPASTRDPAMSSVTLTPPTSPEEVQTVDPQSVQKWVKFSSVSDGFNSDST
SHHGGKIPRKLANHVVDRVWQECNMNRAQNKRKYSASSGGLCEEATAAKVASWDFVEATQ
RTNCSCLRHKNLKSRNAGQQGQAPSLGQQQQILPKHKTNEKQEKSEKPQKRPLTPFHHRV
SVSDDVGMDADSASQRLVISAPDSQVRFSNIRTNDVAKTPQMHGTEMANSPQPPPLSPHP
CDVVDEGVTKTPSTPQSQHFYQMPTPDPLVPSKPMEDRIDSLSQSFPPQYQEAVEPTVYV
GTAVNLEEDEANIAWKYYKFPKKKDVEFLPPQLPSDKFKDDPVGPFGQESVTSVTELMVQ
CKKPLKVSDELVQQYQIKNQCLSAIASDAEQEPKIDPYAFVEGDEEFLFPDKKDRQNSER
EAGKKHKVEDGTSSVTVLSHEEDAMSLFSPSIKQDAPRPTSHARPPSTSLIYDSDLAVSY
TDLDNLFNSDEDELTPGSKKSANGSDDKASCKESKTGNLDPLSCISTADLHKMYPTPPSL
EQHIMGFSPMNMNNKEYGSMDTTPGGTVLEGNSSSIGAQFKIEVDEGFCSPKPSEIKDFS
YVYKPENCQILVGCSMFAPLKTLPSQYLPPIKLPEECIYRQSWTVGKLELLSSGPSMPFI
KEGDGSNMDQEYGTAYTPQTHTSFGMPPSSAPPSNSGAGILPSPSTPRFPTPRTPRTPRT
PRGAGGPASAQGSVKYENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSES
VMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNNSGL
FLEDELDIIGRNTDCGKEAEKRFEALRATSAEHVNGGLKESEKLSDDLILLLQDQCTNLF
SPFGAADQDPFPKSGVISNWVRVEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKSSC
LHPWSKRNDVSMQCSQDILRMLLSLQPVLQDAIQKKRTVRPWGVQGPLTWQQFHKMAGRG
SYGTDESPEPLPIPTFLLGYDYDYLVLSPFALPYWERLMLEPYGSQRDIAYVVLCPENEA
LLNGAKSFFRDLTAIYESCRLGQHRPVSRLLTDGIMRVGSTASKKLSEKLVAEWFSQAAD
GNNEAFSKLKLYAQVCRYDLGPYLASLPLDSSLLSQPNLVAPTSQSLITPPQMTNTGNAN
TPSATLASAASSTMTVTSGVAISTSVATANSTLTTASTSSSSSSNLNSGVSSNKLPSFPP
FGSMNSNAAGSMSTQANTVQSGQLGGQQTSALQTAGISGESSSLPTQPHPDVSESTMDRD
KVGIPTDGDSHAVTYPPAIVVYIIDPFTYENTDESTNSSSVWTLGLLRCFLEMVQTLPPH
IKSTVSVQIIPCQYLLQPVKHEDREIYPQHLKSLAFSAFTQCRRPLPTSTNVKTLTGFGP
GLAMETALRSPDRPECIRLYAPPFILAPVKDKQTELGETFGEAGQKYNVLFVGYCLSHDQ
RWILASCTDLYGELLETCIINIDVPNRARRKKSSARKFGLQKLWEWCLGLVQMSSLPWRV
VIGRLGRIGHGELKDWSCLLSRRNLQSLSKRLKDMCRMCGISAADSPSILSACLVAMEPQ
GSFVIMPDSVSTGSVFGRSTTLNMQTSQLNTPQDTSCTHILVFPTSASVQVASATYTTEN
LDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKG
QSTDRLLSTEPHEEVPNILQQPLALGYFVSTAKAGPLPDWFWSACPQAQYQCPLFLKASL
HLHVPSVQSDELLHSKHSHPLDSNQTSDVLRFVLEQYNALSWLTCDPATQDRRSCLPIHF
VVLNQLYNFIMNML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2VCZ5	0.592	0.611	0.000	2102	0.650	0.673	A2VCZ5.pdb.gz	MD13L_DANRE Mediator of RNA polymerase II transcription subunit 13-like OS=Danio rerio OX=7955 GN=zgc:153454 PE=2 SV=1
2	AFDB:Q6JPI3	0.592	0.583	0.000	2207	0.536	0.528	Q6JPI3.pdb.gz	MD13L_MOUSE Mediator of RNA polymerase II transcription subunit 13-like OS=Mus musculus OX=10090 GN=Med13l PE=1 SV=2
3	AFDB:Q7KTX8	0.431	0.365	0.000	2618	0.317	0.264	Q7KTX8.pdb.gz	MED13_DROME Mediator of RNA polymerase II transcription subunit 13 OS=Drosophila melanogaster OX=7227 GN=skd PE=1 SV=1
4	AFDB:Q9UHV7	1.000	1.000	0.000	2174	1.000	1.000	Q9UHV7.pdb.gz	MED13_HUMAN Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3
5	AFDB:Q54S20	0.186	0.154	8.246E-18	2678	0.129	0.105	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
6	AFDB:F4I096	0.098	0.106	6.491E-16	1921	0.152	0.172	F4I096.pdb.gz	MED13_ARATH Mediator of RNA polymerase II transcription subunit 13 OS=Arabidopsis thaliana OX=3702 GN=MED13 PE=1 SV=1
7	PDB:7kpvD	0.164	0.379	1.133E-10	876	0.036	0.089	7kpvD.pdb.gz
8	PDB:6oonA	0.066	0.160	5.426E-4	785	0.013	0.036	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
9	PDB:4krfA	0.062	0.142	6.648E-4	817	0.013	0.034	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
10	PDB:5weaA	0.069	0.170	1.105E-3	764	0.012	0.034	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
11	PDB:6kr6A	0.069	0.181	1.223E-3	713	0.013	0.041	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
12	PDB:5vm9C	0.068	0.159	2.137E-3	785	0.012	0.033	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
13	PDB:4w5tA	0.066	0.152	2.248E-3	807	0.013	0.036	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
14	PDB:5guhA	0.067	0.149	3.735E-3	759	0.012	0.034	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
15	AFDB:Q13029	0.035	0.041	4.549E-2	1718	0.091	0.115	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
16	AFDB:D3ZRA6	0.050	0.057	6.169E-2	1683	0.118	0.152	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
17	AFDB:F4IZM8	0.036	0.044	7.184E-2	1347	0.093	0.151	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
18	PDB:7swfA	0.059	0.132	7.855E-2	778	0.013	0.036	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
19	AFDB:P11978	0.047	0.064	9.259E-2	1358	0.081	0.130	P11978.pdb.gz	SIR4_YEAST Regulatory protein SIR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIR4 PE=1 SV=1
20	PDB:5datc4	0.029	0.276	1.240E-1	128	0.007	0.117	5datc4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YBV3	0.0	3948	2096	0.899	0.933	A0A8I5YBV3_RAT Mediator of RNA polymerase II transcription subunit 13 OS=Rattus norvegicus OX=10116 GN=Med13 PE=3 SV=1
2	A2VCZ5	0.0	942	2102	0.208	0.215	MD13L_DANRE Mediator of RNA polymerase II transcription subunit 13-like OS=Danio rerio OX=7955 GN=zgc:153454 PE=2 SV=1
3	F1LXU0	0.0	4106	2171	0.934	0.936	F1LXU0_RAT Mediator of RNA polymerase II transcription subunit 13 OS=Rattus norvegicus OX=10116 GN=Med13 PE=1 SV=3
4	Q5SWW4	0.0	4114	2171	0.935	0.936	MED13_MOUSE Mediator of RNA polymerase II transcription subunit 13 OS=Mus musculus OX=10090 GN=Med13 PE=1 SV=1
5	Q6JPI3	0.0	2067	2207	0.536	0.528	MD13L_MOUSE Mediator of RNA polymerase II transcription subunit 13-like OS=Mus musculus OX=10090 GN=Med13l PE=1 SV=2
6	Q9UHV7	0.0	4513	2174	1.000	1.000	MED13_HUMAN Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3
7	Q7KTX8	2.63e-111	399	2618	0.106	0.088	MED13_DROME Mediator of RNA polymerase II transcription subunit 13 OS=Drosophila melanogaster OX=7227 GN=skd PE=1 SV=1
8	Q54S20	7.61e-12	73.9	2678	0.015	0.012	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
9	F4I096	4.44e-06	54.7	1921	0.011	0.013	MED13_ARATH Mediator of RNA polymerase II transcription subunit 13 OS=Arabidopsis thaliana OX=3702 GN=MED13 PE=1 SV=1
10	Q9HE02	7.61e-04	47.4	1225	0.017	0.031	SSN2_SCHPO Mediator of RNA polymerase II transcription subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb9 PE=1 SV=2
11	Q6PFD9	0.50	38.1	1816	0.013	0.016	NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus OX=10090 GN=Nup98 PE=1 SV=2
12	P52948	0.57	37.7	1817	0.013	0.016	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
13	Q8IUW3	0.65	37.4	424	0.018	0.094	SPA2L_HUMAN Spermatogenesis-associated protein 2-like protein OS=Homo sapiens OX=9606 GN=SPATA2L PE=1 SV=1
14	Q57WT5	0.93	37.4	1312	0.024	0.040	Q57WT5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.300 PE=4 SV=1
15	P49793	1.2	37.0	1816	0.013	0.015	NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus OX=10116 GN=Nup98 PE=1 SV=2
16	F4HRJ4	5.2	34.7	609	0.011	0.039	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
17	Q59K07	8.3	33.5	369	0.009	0.051	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06333 Med13_C	6.3e-115	395.6	Mediator complex subunit 13 C-terminal domain
2	PF18296 MID_MedPIWI	2.2e-100	347.3	MID domain of medPIWI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363193	0.999	Mediator of RNA polymerase II transcription subunit 12
2	9606.ENSP00000370938	0.999	Cyclin-dependent kinase 8
3	9606.ENSP00000428982	0.999	Cyclin-C
4	9606.ENSP00000323720	0.998	Mediator of RNA polymerase II transcription subunit 14
5	9606.ENSP00000357907	0.998	Cyclin dependent kinase 19
6	9606.ENSP00000417235	0.997	Mediator of RNA polymerase II transcription subunit 12-like protein
7	9606.ENSP00000286317	0.996	Mediator of RNA polymerase II transcription subunit 7
8	9606.ENSP00000300651	0.996	Mediator of RNA polymerase II transcription subunit 1
9	9606.ENSP00000362948	0.996	Mediator of RNA polymerase II transcription subunit 18
10	9606.ENSP00000481920	0.996	Mediator of RNA polymerase II transcription subunit 6
11	9606.ENSP00000251871	0.995	Mediator of RNA polymerase II transcription subunit 17
12	9606.ENSP00000325612	0.995	Mediator of RNA polymerase II transcription subunit 16
13	9606.ENSP00000282892	0.994	Mediator of RNA polymerase II transcription subunit 21
14	9606.ENSP00000314343	0.994	Mediator of RNA polymerase II transcription subunit 29
15	9606.ENSP00000337340	0.994	Mediator of RNA polymerase II transcription subunit 19
16	9606.ENSP00000255764	0.993	Mediator of RNA polymerase II transcription subunit 10
17	9606.ENSP00000290663	0.993	Mediator of RNA polymerase II transcription subunit 8
18	9606.ENSP00000263390	0.992	Mediator of RNA polymerase II transcription subunit 26
19	9606.ENSP00000292035	0.992	Mediator of RNA polymerase II transcription subunit 27
20	9606.ENSP00000297347	0.991	Mediator of RNA polymerase II transcription subunit 30

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0046966	1.000	nuclear thyroid hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0048522	0.925	positive regulation of cellular process
GO:0006357	0.904	regulation of transcription by RNA polymerase II
GO:0010604	0.896	positive regulation of macromolecule metabolic process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:0031325	0.877	positive regulation of cellular metabolic process
GO:0051254	0.866	positive regulation of RNA metabolic process
GO:0009987	0.851	cellular process
GO:0045893	0.797	positive regulation of DNA-templated transcription
GO:0045944	0.759	positive regulation of transcription by RNA polymerase II
GO:0008152	0.505	metabolic process
GO:0071704	0.483	organic substance metabolic process
GO:0044238	0.434	primary metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:2000142	0.375	regulation of DNA-templated transcription initiation
GO:2000144	0.374	positive regulation of DNA-templated transcription initiation
GO:0060260	0.371	regulation of transcription initiation by RNA polymerase II
GO:0044237	0.368	cellular metabolic process
GO:0043170	0.345	macromolecule metabolic process
GO:0060261	0.339	positive regulation of transcription initiation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0140513	0.968	nuclear protein-containing complex
GO:0016592	0.722	mediator complex
GO:0016020	0.683	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]