StarFunc result for job id Q9UHW9

User Input

>input (1150 residues)
MHPPETTTKMASVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPM
SEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNS
NYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPT
KTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSA
IATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAA
IFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYA
GAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATC
DEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVD
ITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGA
CIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAK
DNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLA
CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFA
SQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGIS
HLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFP
SNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDL
ATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKD
RNSMLRLTSIGSDEDEETETYQEKVHMTWTKDKYMASRGQKAKSMEGFQDLLNMRPDQSN
VRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRG
GGSEVITIYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6m1yA	0.805	0.985	0.000	938	0.815	0.999	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
2	PDB:6m23A	0.790	0.967	0.000	936	0.623	0.766	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
3	PDB:6y5rA	0.739	0.961	0.000	879	0.760	0.994	6y5rA.pdb.gz
4	AFDB:A0A0B4LGD3	0.801	0.855	0.000	1077	0.521	0.556	A0A0B4LGD3.pdb.gz	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
5	AFDB:A0A2R8RX62	0.852	0.854	0.000	1146	0.634	0.636	A0A2R8RX62.pdb.gz
6	AFDB:E9QC71	0.858	0.883	0.000	1117	0.636	0.654	E9QC71.pdb.gz
7	AFDB:Q28677	0.870	0.922	0.000	1085	0.718	0.761	Q28677.pdb.gz	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
8	AFDB:Q5RK27	0.866	0.919	0.000	1083	0.656	0.696	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
9	AFDB:Q63633	0.855	0.864	0.000	1139	0.673	0.680	Q63633.pdb.gz	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
10	AFDB:Q9W1G6	0.804	0.885	0.000	1043	0.530	0.584	Q9W1G6.pdb.gz	Q9W1G6_DROME Kazachoc, isoform A OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2
11	PDB:7airA	0.718	0.926	5.428E-104	885	0.643	0.836	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
12	PDB:7d99A	0.750	0.963	2.566E-103	891	0.587	0.758	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
13	AFDB:H2KZC3	0.512	0.519	4.036E-83	1129	0.447	0.455	H2KZC3.pdb.gz	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
14	PDB:7d14A	0.682	0.913	2.143E-79	850	0.543	0.735	7d14A.pdb.gz
15	AFDB:Q09573	0.693	0.742	2.354E-75	1070	0.356	0.382	Q09573.pdb.gz	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
16	AFDB:Q2UVJ5	0.457	0.520	8.096E-61	975	0.312	0.368	Q2UVJ5.pdb.gz	CCC1_ARATH Cation-chloride cotransporter 1 OS=Arabidopsis thaliana OX=3702 GN=CCC1 PE=1 SV=1
17	PDB:7s1xB	0.411	0.521	1.249E-43	871	0.229	0.302	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7d10A	0.335	0.838	5.318E-24	446	0.145	0.374	7d10A.pdb.gz
19	PDB:7cmhB	0.292	0.678	1.262E-8	458	0.070	0.175	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:5j4nA	0.284	0.673	8.332E-8	437	0.070	0.185	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LGD3	1187	1077	0.522	0.557	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
2	A0A0B4LHE0	1194	1066	0.524	0.566	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
3	B4DF30	1709	1079	0.712	0.759	B4DF30_HUMAN cDNA FLJ60065, highly similar to Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 PE=2 SV=1
4	C0KDV0	935	1061	0.436	0.472	C0KDV0_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
5	G5EEC9	935	1079	0.436	0.464	G5EEC9_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
6	H2KZC2	935	1102	0.436	0.455	H2KZC2_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
7	H2KZC3	936	1129	0.436	0.444	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
8	Q09573	727	1070	0.358	0.385	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
9	Q28677	1726	1085	0.715	0.758	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
10	Q5RK27	1537	1083	0.651	0.692	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
11	Q63633	1602	1139	0.675	0.681	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
12	Q8MKK5	1193	1028	0.522	0.584	Q8MKK5_DROME GH09271p OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
13	Q8MLQ5	1192	1074	0.525	0.562	Q8MLQ5_DROME Kazachoc, isoform D OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
14	Q91V14	1596	1138	0.671	0.678	S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2
15	Q924N4	2354	1150	0.982	0.982	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
16	Q9H2X9	1603	1139	0.680	0.687	S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens OX=9606 GN=SLC12A5 PE=1 SV=3
17	Q9JIS8	1731	1085	0.716	0.759	S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2
18	Q9UHW9	2388	1150	1.000	1.000	S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2
19	Q9UP95	1728	1085	0.719	0.762	S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 PE=1 SV=2
20	Q9W1G5	1191	1059	0.517	0.562	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	2.2e-59	213.0	Amino acid permease
2	PF13520 AA_permease_2	3.9e-14	64.0	Amino acid permease
3	PF03522 SLC12	1.2e-45	167.9	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346112

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348278	0.909	STE20/SPS1-related proline-alanine-rich protein kinase
2	9606.ENSP00000341292	0.795	Serine/threonine-protein kinase WNK1
3	9606.ENSP00000346667	0.792	Serine/threonine-protein kinase WNK3
4	9606.ENSP00000297954	0.744	Serine/threonine-protein kinase WNK2
5	9606.ENSP00000365730	0.701	Serine/threonine-protein kinase 24
6	9606.ENSP00000337008	0.691	Zinc finger protein 644
7	9606.ENSP00000261866	0.679	Spatacsin
8	9606.ENSP00000311713	0.677	Serine/threonine-protein kinase OSR1
9	9606.ENSP00000329932	0.675	Galectin-9C
10	9606.ENSP00000246914	0.674	Serine/threonine-protein kinase WNK4
11	9606.ENSP00000262418	0.662	Band 3 anion transport protein
12	9606.ENSP00000281172	0.630	Epidermal growth factor receptor kinase substrate 8
13	9606.ENSP00000360916	0.612	Guanine nucleotide exchange factor VAV2
14	9606.ENSP00000328352	0.586	BTB/POZ domain-containing protein KCTD11
15	9606.ENSP00000254286	0.557	Actin related protein 10 homolog
16	9606.ENSP00000354721	0.553	Sulfate anion transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	1.000	potassium:chloride symporter activity
GO:0005488	0.885	binding
GO:0005515	0.884	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.983	cellular process
GO:0051179	0.939	localization
GO:0006811	0.927	monoatomic ion transport
GO:0051716	0.738	cellular response to stimulus
GO:0042221	0.717	response to chemical
GO:0065007	0.658	biological regulation
GO:0070887	0.642	cellular response to chemical stimulus
GO:0009628	0.461	response to abiotic stimulus
GO:0050789	0.390	regulation of biological process
GO:0055085	0.380	transmembrane transport
GO:0042592	0.333	homeostatic process
GO:0034220	0.323	monoatomic ion transmembrane transport
GO:0048878	0.321	chemical homeostasis
GO:0050794	0.315	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.755	intracellular anatomical structure
GO:0005737	0.739	cytoplasm
GO:0043227	0.724	membrane-bounded organelle
GO:0042995	0.488	cell projection
GO:0120025	0.480	plasma membrane bounded cell projection
GO:0043229	0.323	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]