StarFunc result for job id Q9UHX1

User Input

>input (559 residues)
MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLT
PEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQ
RQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVP
EAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD
DIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVG
KAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTL
AQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKE
EEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLE
GEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGR
KVVAEVYDQERFDNSDLSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHX1	1.000	1.000	1.093E-98	559	1.000	1.000	Q9UHX1.pdb.gz	PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
2	AFDB:Q8T6B9	0.374	0.329	1.506E-56	637	0.524	0.460	Q8T6B9.pdb.gz	PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster OX=7227 GN=hfp PE=1 SV=2
3	AFDB:E9PN18	0.227	0.475	7.729E-29	263	0.392	0.833	E9PN18.pdb.gz	E9PN18_HUMAN Poly(U) binding splicing factor 60 (Fragment) OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
4	AFDB:A0A384NQ03	0.157	0.166	8.623E-24	530	0.163	0.172	A0A384NQ03.pdb.gz	A0A384NQ03_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:O13845	0.150	0.140	1.645E-23	603	0.182	0.169	O13845.pdb.gz	RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsd1 PE=1 SV=2
6	AFDB:F1QM02	0.155	0.246	1.210E-22	340	0.125	0.206	F1QM02.pdb.gz
7	AFDB:P53316	0.167	0.126	9.317E-21	781	0.122	0.087	P53316.pdb.gz	YG5B_YEAST Uncharacterized RNA-binding protein YGR250C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR250C PE=1 SV=1
8	AFDB:Q9XVS2	0.141	0.173	3.811E-20	454	0.168	0.207	Q9XVS2.pdb.gz	Q9XVS2_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-46 PE=1 SV=1
9	AFDB:Q9IBD0	0.141	0.156	4.286E-20	501	0.165	0.184	Q9IBD0.pdb.gz	CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio OX=7955 GN=celf1 PE=1 SV=1
10	AFDB:A2A5N3	0.145	0.134	3.988E-19	607	0.132	0.122	A2A5N3.pdb.gz	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
11	PDB:6lurD	0.184	0.474	4.042E-17	213	0.182	0.479	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
12	PDB:5vsuA	0.149	0.201	4.632E-14	387	0.086	0.124	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y53o	0.136	0.462	1.763E-12	160	0.089	0.312	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6r5kH	0.134	0.188	4.010E-12	394	0.138	0.195	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:7oqcF	0.147	0.296	9.121E-12	267	0.095	0.199	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	PDB:7evoD	0.139	0.370	1.207E-10	200	0.086	0.240	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5lsbA	0.136	0.421	1.339E-9	176	0.064	0.205	5lsbA.pdb.gz
18	PDB:6y5qq	0.127	0.378	1.905E-9	178	0.082	0.258	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:6qx91K	0.151	0.382	5.099E-8	201	0.064	0.179	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:6ff7X	0.121	0.364	6.448E-8	171	0.047	0.152	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PQ56	0.0	637	322	0.569	0.988	E9PQ56_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=9
2	H0YEM1	0.0	678	336	0.596	0.991	H0YEM1_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=2
3	Q9UHX1	0.0	1140	559	1.000	1.000	PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
4	Q8T6B9	2.19e-163	481	637	0.515	0.452	PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster OX=7227 GN=hfp PE=1 SV=2
5	E9PN18	1.85e-152	439	263	0.392	0.833	E9PN18_HUMAN Poly(U) binding splicing factor 60 (Fragment) OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
6	E9PMU7	2.48e-139	405	247	0.363	0.822	E9PMU7_HUMAN Poly(U) binding splicing factor 60 (Fragment) OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
7	E9PL19	2.45e-128	376	228	0.329	0.807	E9PL19_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=2
8	Q13310	2.61e-24	109	644	0.122	0.106	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
9	B1ANR0	2.74e-24	109	615	0.122	0.111	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
10	A3KFU5	1.08e-23	107	631	0.120	0.106	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
11	Q91YZ8	1.28e-23	107	615	0.120	0.109	Q91YZ8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
12	Q6PHQ9	1.44e-23	107	660	0.120	0.102	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
13	Q99LF8	1.50e-23	107	660	0.120	0.102	Q99LF8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1
14	A3KFU8	1.65e-23	107	644	0.120	0.104	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
15	H0Y5F5	2.46e-23	106	550	0.100	0.102	H0Y5F5_HUMAN Polyadenylate-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
16	Q3UX16	3.97e-23	105	590	0.107	0.102	Q3UX16_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1
17	A0A087WTT1	1.64e-22	103	588	0.107	0.102	A0A087WTT1_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
18	Q2UK72	1.88e-22	103	765	0.106	0.077	PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pab1 PE=3 SV=1
19	B2RXY9	5.10e-22	102	607	0.102	0.094	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
20	A2A5N3	5.24e-22	102	607	0.102	0.094	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08206 OB_RNB	2.5e+02	12.7	Ribonuclease B OB domain
2	PF00076 RRM_1	3.9e-39	143.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	0.0055	28.1	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002788

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008368	0.986	Splicing factor 3b, subunit 1, 155kDa
2	61853.ENSNLEP00000011932	0.980	Far upstream element (FUSE) binding protein 1
3	61853.ENSNLEP00000019568	0.980	Splicing factor 3b, subunit 3, 130kDa
4	61853.ENSNLEP00000018945	0.969	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
5	61853.ENSNLEP00000007065	0.967	Small nuclear ribonucleoprotein polypeptide F
6	61853.ENSNLEP00000002730	0.964	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
7	61853.ENSNLEP00000006721	0.940	Calcium homeostasis endoplasmic reticulum protein
8	61853.ENSNLEP00000006018	0.939	U2 snRNP-associated SURP domain containing
9	61853.ENSNLEP00000002587	0.933	Uncharacterized protein
10	61853.ENSNLEP00000023868	0.931	Serine/arginine-rich splicing factor 1
11	61853.ENSNLEP00000008303	0.924	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
12	61853.ENSNLEP00000007295	0.918	Splicing factor 3b, subunit 2, 145kDa
13	61853.ENSNLEP00000022846	0.918	Small nuclear ribonucleoprotein polypeptide E
14	61853.ENSNLEP00000008378	0.907	Heat shock 60kDa protein 1 (chaperonin)
15	61853.ENSNLEP00000018780	0.907	Survival motor neuron domain containing 1
16	61853.ENSNLEP00000012869	0.889	Necessary for the splicing of pre-mRNA.
17	61853.ENSNLEP00000019318	0.860	KH-type splicing regulatory protein
18	61853.ENSNLEP00000012409	0.852	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
19	61853.ENSNLEP00000022994	0.852	Small nuclear ribonucleoprotein polypeptide G
20	61853.ENSNLEP00000003432	0.820	RNA binding motif protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0050839	0.995	cell adhesion molecule binding
GO:0045296	0.994	cadherin binding
GO:0042802	0.945	identical protein binding
GO:0003729	0.482	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.989	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0031323	0.950	regulation of cellular metabolic process
GO:1903311	0.939	regulation of mRNA metabolic process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0010468	0.896	regulation of gene expression
GO:0043170	0.861	macromolecule metabolic process
GO:0010467	0.805	gene expression
GO:0016070	0.799	RNA metabolic process
GO:0006396	0.774	RNA processing
GO:0043484	0.772	regulation of RNA splicing
GO:0050684	0.731	regulation of mRNA processing
GO:0016071	0.676	mRNA metabolic process
GO:0006397	0.671	mRNA processing
GO:0048024	0.612	regulation of mRNA splicing, via spliceosome
GO:0000375	0.595	RNA splicing, via transesterification reactions
GO:0000398	0.577	mRNA splicing, via spliceosome
GO:0048519	0.553	negative regulation of biological process
GO:0071840	0.502	cellular component organization or biogenesis
GO:0016043	0.453	cellular component organization
GO:0048518	0.313	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.893	protein-containing complex
GO:0030054	0.831	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]