StarFunc result for job id Q9UI08

User Input

>input (416 residues)
MSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVV
INYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPS
SQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSCS
GPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDESSMSGLAAAIAGAKLRRVQRPED
ASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQSDKPAEKKEDESQMED
PSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQP
HSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08719	0.419	0.416	1.161E-53	420	0.938	0.929	O08719.pdb.gz	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
2	AFDB:A0A024R0V4	0.281	0.307	2.969E-28	380	0.464	0.508	A0A024R0V4.pdb.gz	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
3	AFDB:P70460	0.291	0.321	9.937E-28	375	0.442	0.491	P70460.pdb.gz	VASP_MOUSE Vasodilator-stimulated phosphoprotein OS=Mus musculus OX=10090 GN=Vasp PE=1 SV=4
4	AFDB:G5EG53	0.304	0.276	2.919E-17	468	0.260	0.231	G5EG53.pdb.gz	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
5	AFDB:Q9NPI6	0.238	0.173	1.713E-7	582	0.132	0.095	Q9NPI6.pdb.gz	DCP1A_HUMAN mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3
6	AFDB:Q3U564	0.256	0.188	3.044E-7	578	0.137	0.099	Q3U564.pdb.gz	DCP1B_MOUSE mRNA-decapping enzyme 1B OS=Mus musculus OX=10090 GN=Dcp1b PE=1 SV=1
7	PDB:3m1iB	0.235	0.692	3.121E-7	131	0.058	0.183	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
8	AFDB:Q91YD3	0.238	0.168	3.225E-7	602	0.142	0.098	Q91YD3.pdb.gz	DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus OX=10090 GN=Dcp1a PE=1 SV=1
9	AFDB:Q8IZD4	0.272	0.189	1.143E-6	617	0.139	0.094	Q8IZD4.pdb.gz	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
10	PDB:1k5dB	0.248	0.669	2.778E-6	146	0.036	0.103	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
11	AFDB:P49797	0.207	0.095	3.400E-4	967	0.154	0.066	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
12	AFDB:Q22354	0.193	0.100	6.401E-4	862	0.120	0.058	Q22354.pdb.gz	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
13	PDB:6oxlN	0.217	0.627	1.647E-3	124	0.041	0.137	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
14	PDB:5yqrA	0.168	0.246	3.904E-3	268	0.024	0.037	5yqrA.pdb.gz
15	PDB:4iapA	0.147	0.224	1.466E-2	256	0.029	0.047	4iapA.pdb.gz
16	PDB:4gouA	0.190	0.159	2.323E-2	507	0.031	0.026	4gouA.pdb.gz
17	PDB:4mt6A	0.167	0.177	2.606E-2	389	0.031	0.033	4mt6A.pdb.gz
18	PDB:6xtbE	0.164	0.264	3.097E-2	235	0.034	0.060	6xtbE.pdb.gz
19	PDB:2kr0A	0.198	0.202	3.475E-2	407	0.034	0.034	2kr0A.pdb.gz
20	PDB:7rroT	0.124	0.117	4.129E-2	452	0.024	0.022	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08719	0.0	669	420	0.938	0.929	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
2	P70429	0.0	670	414	0.940	0.944	EVL_MOUSE Ena/VASP-like protein OS=Mus musculus OX=10090 GN=Evl PE=1 SV=2
3	Q9UI08	0.0	844	416	1.000	1.000	EVL_HUMAN Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2
4	P70460	7.00e-79	250	375	0.438	0.485	VASP_MOUSE Vasodilator-stimulated phosphoprotein OS=Mus musculus OX=10090 GN=Vasp PE=1 SV=4
5	Q5XHX3	2.98e-61	208	526	0.233	0.184	Q5XHX3_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
6	A0A4D6J698	4.97e-61	209	570	0.233	0.170	A0A4D6J698_HUMAN Mena delta 11a OS=Homo sapiens OX=9606 PE=2 SV=1
7	A0A0G2K6I4	5.69e-61	209	563	0.233	0.172	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2
8	Q8N8S7	1.12e-60	208	591	0.233	0.164	ENAH_HUMAN Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2
9	A0A8I5ZND4	3.22e-60	207	570	0.233	0.170	A0A8I5ZND4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
10	A0A8I5Y4S4	8.32e-60	209	805	0.236	0.122	A0A8I5Y4S4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
11	A0A8I6G5W6	7.79e-58	204	788	0.236	0.124	A0A8I6G5W6_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
12	A0A8I6GMP8	5.66e-57	202	788	0.233	0.123	A0A8I6GMP8_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
13	A0A0U1RRM6	7.18e-57	201	802	0.233	0.121	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
14	A0A8I5ZT50	1.12e-55	198	803	0.236	0.122	A0A8I5ZT50_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
15	Q03173	2.80e-55	197	802	0.233	0.121	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
16	A0A024R0V4	8.00e-49	172	380	0.212	0.232	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
17	P50552	8.00e-49	172	380	0.212	0.232	VASP_HUMAN Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3
18	Q8T4F7	2.71e-40	155	980	0.168	0.071	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
19	G5EG53	1.24e-17	86.7	468	0.103	0.092	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
20	H2L0C7	9.61e-14	73.9	310	0.089	0.119	H2L0C7_CAEEL WH1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18070 Cas9_PI2	1.1e+02	15.0	CRISPR-Cas9 PI domain
2	PF01344 Kelch_1	1.4e+02	13.4	Kelch motif
3	PF00638 Ran_BP1	9	18.0	RanBP1 domain
4	PF08776 VASP_tetra	9.9e-16	68.3	VASP tetramerisation domain
5	PF00568 WH1	1e-31	120.5	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000013213

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000009412	0.983	annotation not available
2	9555.ENSPANP00000000872	0.974	Uncharacterized protein
3	9555.ENSPANP00000020009	0.946	Amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
4	9555.ENSPANP00000016331	0.855	Belongs to the actin family.
5	9555.ENSPANP00000010861	0.835	Actin, gamma 1
6	9555.ENSPANP00000019562	0.814	Profilin 1
7	9555.ENSPANP00000018031	0.810	Belongs to the profilin family.
8	9555.ENSPANP00000005837	0.799	Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
9	9555.ENSPANP00000013909	0.779	Belongs to the profilin family.
10	9555.ENSPANP00000009610	0.752	Actin, beta
11	9555.ENSPANP00000011336	0.752	Uncharacterized protein
12	9555.ENSPANP00000002993	0.747	Zyxin
13	9555.ENSPANP00000012445	0.712	Belongs to the actin family.
14	9555.ENSPANP00000001925	0.711	Tyrosine-protein kinase
15	9555.ENSPANP00000018832	0.711	ABL proto-oncogene 1, non-receptor tyrosine kinase
16	9555.ENSPANP00000014144	0.699	Immunoglobulin superfamily, DCC subclass, member 3
17	9555.ENSPANP00000020588	0.686	WAS/WASL interacting protein family, member 2
18	9555.ENSPANP00000006409	0.678	Profilin family, member 4
19	9555.ENSPANP00000007033	0.652	Uncharacterized protein
20	9555.ENSPANP00000006680	0.638	Actin, alpha 1, skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0044087	0.995	regulation of cellular component biogenesis
GO:0048522	0.995	positive regulation of cellular process
GO:0032956	0.995	regulation of actin cytoskeleton organization
GO:0110053	0.992	regulation of actin filament organization
GO:0030029	0.987	actin filament-based process
GO:0051130	0.985	positive regulation of cellular component organization
GO:0030036	0.978	actin cytoskeleton organization
GO:0097435	0.976	supramolecular fiber organization
GO:0044089	0.973	positive regulation of cellular component biogenesis
GO:1902905	0.972	positive regulation of supramolecular fiber organization
GO:0051495	0.971	positive regulation of cytoskeleton organization
GO:0007015	0.970	actin filament organization
GO:0050896	0.961	response to stimulus
GO:0032273	0.950	positive regulation of protein polymerization
GO:0030833	0.845	regulation of actin filament polymerization
GO:0032501	0.783	multicellular organismal process
GO:0040012	0.773	regulation of locomotion
GO:0051716	0.765	cellular response to stimulus
GO:0048856	0.679	anatomical structure development
GO:0048519	0.667	negative regulation of biological process
GO:0048523	0.648	negative regulation of cellular process
GO:0007275	0.512	multicellular organism development
GO:2000145	0.460	regulation of cell motility
GO:0032231	0.355	regulation of actin filament bundle assembly
GO:0110020	0.350	regulation of actomyosin structure organization
GO:0048731	0.344	system development
GO:0051492	0.335	regulation of stress fiber assembly
GO:0030334	0.310	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.997	organelle
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0016020	0.984	membrane
GO:0031982	0.950	vesicle
GO:0030054	0.851	cell junction
GO:0070161	0.773	anchoring junction
GO:0071944	0.749	cell periphery
GO:0005886	0.731	plasma membrane
GO:0005925	0.719	focal adhesion
GO:0031252	0.672	cell leading edge
GO:0120025	0.646	plasma membrane bounded cell projection
GO:0030027	0.489	lamellipodium
GO:0031410	0.396	cytoplasmic vesicle
GO:0043232	0.367	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]