StarFunc result for job id Q9UI10

User Input

>input (523 residues)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UI10	1.000	1.000	4.314E-88	523	1.000	1.000	Q9UI10.pdb.gz	EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2
2	AFDB:Q63186	0.711	0.710	7.479E-73	524	0.876	0.874	Q63186.pdb.gz	EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1
3	PDB:7l7gF	0.674	0.984	1.385E-61	357	0.681	0.997	7l7gF.pdb.gz	eIF2B conformation and assembly state regulates the integrated stress response.
4	AFDB:Q09924	0.643	0.720	2.412E-44	467	0.329	0.368	Q09924.pdb.gz	EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif224 PE=1 SV=1
5	AFDB:P12754	0.598	0.482	5.443E-38	651	0.325	0.261	P12754.pdb.gz	EI2BD_YEAST Translation initiation factor eIF-2B subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD2 PE=1 SV=1
6	PDB:6jlyG	0.634	0.904	1.220E-36	363	0.298	0.430	6jlyG.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
7	PDB:6i3mC	0.596	0.901	1.521E-30	342	0.260	0.398	6i3mC.pdb.gz	The structural basis of translational control by eIF2 phosphorylation.
8	PDB:6qg0G	0.603	0.875	1.345E-25	355	0.224	0.330	6qg0G.pdb.gz	Structural basis for the inhibition of translation through eIF2 alpha phosphorylation.
9	AFDB:Q4FKA6	0.535	0.449	2.488E-25	628	0.256	0.213	Q4FKA6.pdb.gz	Q4FKA6_TRYB2 Translation initiation factor eIF2B delta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.1400 PE=3 SV=1
10	AFDB:G5EFF9	0.556	0.551	1.935E-24	529	0.199	0.197	G5EFF9.pdb.gz	G5EFF9_CAEEL Translation initiation factor eIF-2B subunit delta OS=Caenorhabditis elegans OX=6239 GN=eif-2bdelta PE=1 SV=1
11	AFDB:A0A1P8AVS2	0.484	0.605	6.347E-24	409	0.163	0.208	A0A1P8AVS2.pdb.gz	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
12	PDB:5b04C	0.495	0.713	1.147E-22	349	0.157	0.235	5b04C.pdb.gz
13	AFDB:P49770	0.483	0.692	2.932E-22	351	0.140	0.208	P49770.pdb.gz	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
14	AFDB:Q14232	0.474	0.778	1.071E-21	305	0.136	0.233	Q14232.pdb.gz	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
15	AFDB:B3H7H1	0.496	0.623	1.741E-21	409	0.159	0.203	B3H7H1.pdb.gz	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
16	PDB:7f66C	0.475	0.709	5.590E-21	335	0.140	0.218	7f66C.pdb.gz
17	PDB:3ecsC	0.464	0.797	2.401E-20	294	0.136	0.241	3ecsC.pdb.gz	Crystal structure of the alpha subunit of human translation initiation factor 2B
18	PDB:5b04B	0.469	0.742	3.903E-20	319	0.159	0.260	5b04B.pdb.gz
19	PDB:7kmaB	0.420	0.782	1.505E-19	268	0.138	0.269	7kmaB.pdb.gz	Sugar phosphate activation of the stress sensor eIF2B.
20	PDB:6ezoD	0.439	0.704	4.357E-17	308	0.147	0.250	6ezoD.pdb.gz	Binding of ISRIB reveals a regulatory site in the nucleotide exchange factor eIF2B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63186	0.0	878	524	0.876	0.874	EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1
2	Q9UI10	0.0	1066	523	1.000	1.000	EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2
3	Q09924	6.35e-97	303	467	0.294	0.330	EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif224 PE=1 SV=1
4	P12754	1.13e-69	237	651	0.266	0.214	EI2BD_YEAST Translation initiation factor eIF-2B subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD2 PE=1 SV=1
5	Q64270	3.13e-25	107	305	0.122	0.210	EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus OX=10116 GN=Eif2b1 PE=2 SV=1
6	Q99LC8	4.75e-25	107	305	0.120	0.207	EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus OX=10090 GN=Eif2b1 PE=1 SV=1
7	Q14232	3.10e-24	105	305	0.120	0.207	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
8	Q4FKA6	1.71e-21	100	628	0.199	0.166	Q4FKA6_TRYB2 Translation initiation factor eIF2B delta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.1400 PE=3 SV=1
9	B3H7H1	8.64e-20	94.0	409	0.126	0.161	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
10	G5EFF9	1.29e-19	94.4	529	0.153	0.151	G5EFF9_CAEEL Translation initiation factor eIF-2B subunit delta OS=Caenorhabditis elegans OX=6239 GN=eif-2bdelta PE=1 SV=1
11	G5EG28	1.40e-19	94.0	497	0.153	0.161	G5EG28_CAEEL Translation initiation factor eIF-2B subunit delta OS=Caenorhabditis elegans OX=6239 GN=eif-2bdelta PE=1 SV=1
12	Q9UT76	1.19e-18	90.1	393	0.117	0.155	EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif222 PE=1 SV=1
13	P49770	3.19e-18	88.6	351	0.126	0.188	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
14	Q53XC2	3.19e-18	88.6	351	0.126	0.188	Q53XC2_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
15	Q9BPX4	3.31e-18	88.2	351	0.126	0.188	Q9BPX4_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
16	Q62818	6.63e-18	87.4	351	0.126	0.188	EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2b2 PE=2 SV=1
17	Q9USP0	7.19e-18	87.0	341	0.151	0.232	EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif221 PE=1 SV=1
18	P34604	1.36e-16	82.8	305	0.094	0.161	EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans OX=6239 GN=ZK1098.4 PE=1 SV=1
19	A0A1P8AVS2	8.25e-16	81.6	409	0.122	0.156	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
20	Q9VAD4	1.59e-13	73.6	306	0.115	0.196	Q9VAD4_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01008 IF-2B	3.3e-87	303.9	Initiation factor 2 subunit family
2	PF05644 Miff	9e+02	10.9	Mitochondrial and peroxisomal fission factor Mff

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000010705

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000007271	0.998	Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
2	9593.ENSGGOP00000000263	0.997	Eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
3	9593.ENSGGOP00000000506	0.995	Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa
4	9593.ENSGGOP00000008957	0.995	Eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
5	9593.ENSGGOP00000001580	0.992	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
6	9593.ENSGGOP00000015167	0.989	Eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
7	9593.ENSGGOP00000004018	0.976	Uncharacterized protein
8	9593.ENSGGOP00000025359	0.943	Uncharacterized protein
9	9593.ENSGGOP00000010712	0.859	Sorting nexin 17
10	9593.ENSGGOP00000011328	0.840	All-trans retinoic acid-induced differentiation factor
11	9593.ENSGGOP00000007675	0.797	Eukaryotic translation initiation factor 5
12	9593.ENSGGOP00000010360	0.797	GDP-mannose pyrophosphorylase B
13	9593.ENSGGOP00000024264	0.771	Eukaryotic translation initiation factor 2 alpha kinase 4
14	9593.ENSGGOP00000015209	0.762	Belongs to the protein kinase superfamily. Tyr protein kinase family
15	9593.ENSGGOP00000015826	0.676	Eukaryotic translation initiation factor 2-alpha kinase 1
16	9593.ENSGGOP00000001427	0.657	Eukaryotic elongation factor, selenocysteine-tRNA-specific
17	9593.ENSGGOP00000002687	0.624	GDP-mannose pyrophosphorylase A
18	9593.ENSGGOP00000017065	0.618	Abhydrolase domain containing 3
19	9593.ENSGGOP00000004316	0.606	GCN1, eIF2 alpha kinase activator homolog
20	9593.ENSGGOP00000010412	0.572	Cdk5 and Abl enzyme substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0003743	0.999	translation initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0065007	0.968	biological regulation
GO:0048731	0.932	system development
GO:0050896	0.926	response to stimulus
GO:0008152	0.919	metabolic process
GO:0071704	0.891	organic substance metabolic process
GO:0044238	0.874	primary metabolic process
GO:0044237	0.843	cellular metabolic process
GO:0006807	0.838	nitrogen compound metabolic process
GO:0043170	0.828	macromolecule metabolic process
GO:1901564	0.743	organonitrogen compound metabolic process
GO:1901576	0.738	organic substance biosynthetic process
GO:0050789	0.735	regulation of biological process
GO:0044249	0.735	cellular biosynthetic process
GO:0050794	0.711	regulation of cellular process
GO:0034641	0.685	cellular nitrogen compound metabolic process
GO:0006412	0.675	translation
GO:0006950	0.665	response to stress
GO:0048518	0.579	positive regulation of biological process
GO:0006413	0.480	translational initiation
GO:0051716	0.475	cellular response to stimulus
GO:0009628	0.462	response to abiotic stimulus
GO:0009266	0.428	response to temperature stimulus
GO:0007399	0.396	nervous system development
GO:0048513	0.368	animal organ development
GO:0007417	0.335	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005851	0.999	eukaryotic translation initiation factor 2B complex
GO:0005829	0.971	cytosol
GO:0043231	0.395	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]