StarFunc result for job id Q9UI15

User Input

>input (199 residues)
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R1Q8	0.961	0.961	1.042E-30	199	0.995	0.995	Q9R1Q8.pdb.gz	TAGL3_MOUSE Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE=1 SV=1
2	AFDB:P37802	0.867	0.867	8.605E-25	199	0.698	0.698	P37802.pdb.gz	TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3
3	AFDB:A0A2R8QQS8	0.879	0.814	8.005E-24	216	0.698	0.644	A0A2R8QQS8.pdb.gz
4	AFDB:P31232	0.927	0.918	4.814E-23	201	0.663	0.657	P31232.pdb.gz	TAGL_RAT Transgelin OS=Rattus norvegicus OX=10116 GN=Tagln PE=1 SV=2
5	AFDB:P26932	0.684	0.488	2.393E-14	292	0.407	0.277	P26932.pdb.gz	CNN1_CHICK Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2
6	AFDB:Q4F876	0.693	0.472	5.199E-14	307	0.422	0.274	Q4F876.pdb.gz
7	AFDB:P51911	0.720	0.508	6.311E-14	297	0.422	0.283	P51911.pdb.gz	CNN1_HUMAN Calponin-1 OS=Homo sapiens OX=9606 GN=CNN1 PE=1 SV=2
8	AFDB:Q9VZI1	0.673	0.711	7.300E-14	188	0.417	0.441	Q9VZI1.pdb.gz	Q9VZI1_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=2
9	AFDB:Q99439	0.672	0.456	1.306E-13	309	0.407	0.262	Q99439.pdb.gz	CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4
10	AFDB:P37397	0.725	0.464	1.925E-13	330	0.427	0.258	P37397.pdb.gz	CNN3_RAT Calponin-3 OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1
11	PDB:7sx8D	0.424	0.207	2.142E-1	448	0.095	0.042	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
12	PDB:3axjB	0.172	0.150	8.740E-1	240	0.095	0.079	3axjB.pdb.gz
13	PDB:1klxA	0.164	0.227	1.564	133	0.080	0.120	1klxA.pdb.gz
14	PDB:4f7rD	0.185	0.162	1.564	238	0.106	0.088	4f7rD.pdb.gz
15	PDB:6jhoA	0.143	0.142	1.564	200	0.090	0.090	6jhoA.pdb.gz
16	PDB:5xjt2	0.146	0.137	1.642	217	0.121	0.111	5xjt2.pdb.gz	Structures of 7S mutant complexes
17	PDB:3geiC	0.172	0.133	1.899	298	0.141	0.094	3geiC.pdb.gz
18	PDB:4d1eA	0.388	0.105	1.899	859	0.101	0.023	4d1eA.pdb.gz
19	PDB:6h3pA	0.127	0.114	1.993	245	0.116	0.094	6h3pA.pdb.gz
20	PDB:3bjcA	0.151	0.110	2.092	311	0.080	0.051	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UI15	7.45e-151	417	199	1.000	1.000	TAGL3_HUMAN Transgelin-3 OS=Homo sapiens OX=9606 GN=TAGLN3 PE=1 SV=2
2	Q9R1Q8	3.95e-150	416	199	0.995	0.995	TAGL3_MOUSE Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE=1 SV=1
3	P37802	2.16e-106	305	199	0.698	0.698	TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3
4	Q6TGT5	5.63e-101	291	201	0.678	0.672	Q6TGT5_DANRE Transgelin OS=Danio rerio OX=7955 GN=TAGLN PE=1 SV=1
5	Q01995	5.80e-99	286	201	0.683	0.677	TAGL_HUMAN Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4
6	P31232	3.31e-98	285	201	0.668	0.662	TAGL_RAT Transgelin OS=Rattus norvegicus OX=10116 GN=Tagln PE=1 SV=2
7	Q9GK38	1.08e-43	149	297	0.422	0.283	CNN1_MUSPF Calponin-1 OS=Mustela putorius furo OX=9669 GN=CNN1 PE=1 SV=1
8	Q08290	1.21e-43	149	297	0.422	0.283	CNN1_RAT Calponin-1 OS=Rattus norvegicus OX=10116 GN=Cnn1 PE=1 SV=1
9	Q15417	6.22e-43	148	329	0.442	0.267	CNN3_HUMAN Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1
10	P37397	6.30e-43	148	330	0.442	0.267	CNN3_RAT Calponin-3 OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1
11	Q1HQ70	8.32e-43	144	188	0.432	0.457	Q1HQ70_BOMMO Transgelin OS=Bombyx mori OX=7091 GN=732906 PE=1 SV=1
12	P51911	1.20e-42	146	297	0.422	0.283	CNN1_HUMAN Calponin-1 OS=Homo sapiens OX=9606 GN=CNN1 PE=1 SV=2
13	Q9VZI1	2.28e-42	142	188	0.422	0.447	Q9VZI1_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=2
14	Q6PBA5	3.48e-42	145	307	0.417	0.270	Q6PBA5_DANRE Calponin OS=Danio rerio OX=7955 GN=wu:fb93a05 PE=1 SV=1
15	P26932	1.08e-40	141	292	0.412	0.281	CNN1_CHICK Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2
16	M9PE30	4.98e-39	134	175	0.402	0.457	M9PE30_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=1
17	P14318	5.37e-39	134	184	0.402	0.435	MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster OX=7227 GN=Mp20 PE=2 SV=2
18	Q99439	1.75e-38	136	309	0.407	0.262	CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4
19	Q08093	5.07e-38	135	305	0.407	0.266	CNN2_MOUSE Calponin-2 OS=Mus musculus OX=10090 GN=Cnn2 PE=1 SV=1
20	Q08873	3.43e-18	80.5	200	0.312	0.310	SCP1_YEAST Transgelin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00402 Calponin	3.4e-11	53.8	Calponin family repeat
2	PF06395 CDC24	6.4e+02	12.0	CDC24 Calponin
3	PF00307 CH	1.1e-17	75.5	Calponin homology (CH) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005060

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012544	0.781	Uncharacterized protein
2	61853.ENSNLEP00000003976	0.777	acyl-CoA dehydrogenase family, member 11
3	61853.ENSNLEP00000013582	0.777	Ubiquitin-conjugating enzyme E2F (putative)
4	61853.ENSNLEP00000000938	0.775	Peptidylprolyl isomerase
5	61853.ENSNLEP00000011403	0.771	Peptidylprolyl isomerase
6	61853.ENSNLEP00000002038	0.733	Regulator of microtubule dynamics 1
7	61853.ENSNLEP00000014474	0.728	acyl-CoA oxidase 3, pristanoyl
8	61853.ENSNLEP00000016216	0.728	Ubiquitin-conjugating enzyme E2 variant 2
9	61853.ENSNLEP00000019978	0.716	Antioxidant 1 copper chaperone
10	61853.ENSNLEP00000000229	0.701	Belongs to the ubiquitin-conjugating enzyme family.
11	61853.ENSNLEP00000022536	0.701	Ubiquitin conjugating enzyme E2 L5, pseudogene
12	61853.ENSNLEP00000018822	0.649	Uncharacterized protein
13	61853.ENSNLEP00000023255	0.649	Actin, gamma 1
14	61853.ENSNLEP00000022158	0.646	Uncharacterized protein
15	61853.ENSNLEP00000022754	0.646	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
16	61853.ENSNLEP00000023580	0.646	Uncharacterized protein
17	61853.ENSNLEP00000020406	0.631	Vinculin
18	61853.ENSNLEP00000011787	0.628	Destrin (actin depolymerizing factor)
19	61853.ENSNLEP00000020424	0.581	Hyaluronan binding protein 4
20	61853.ENSNLEP00000005085	0.580	Transmembrane protease, serine 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.983	cytoskeletal protein binding
GO:0003779	0.905	actin binding
GO:0044877	0.625	protein-containing complex binding
GO:0050839	0.555	cell adhesion molecule binding
GO:0045296	0.546	cadherin binding
GO:0051015	0.508	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.983	anatomical structure development
GO:0009987	0.976	cellular process
GO:0050794	0.967	regulation of cellular process
GO:0032501	0.850	multicellular organismal process
GO:0019222	0.800	regulation of metabolic process
GO:0060255	0.769	regulation of macromolecule metabolic process
GO:0048519	0.761	negative regulation of biological process
GO:0051171	0.745	regulation of nitrogen compound metabolic process
GO:0080090	0.740	regulation of primary metabolic process
GO:0031323	0.730	regulation of cellular metabolic process
GO:0048523	0.718	negative regulation of cellular process
GO:0007275	0.581	multicellular organism development
GO:0010468	0.571	regulation of gene expression
GO:0009889	0.566	regulation of biosynthetic process
GO:0051252	0.566	regulation of RNA metabolic process
GO:0009892	0.553	negative regulation of metabolic process
GO:0010605	0.531	negative regulation of macromolecule metabolic process
GO:0010556	0.514	regulation of macromolecule biosynthetic process
GO:0031326	0.513	regulation of cellular biosynthetic process
GO:0048731	0.490	system development
GO:1903506	0.477	regulation of nucleic acid-templated transcription
GO:0007399	0.465	nervous system development
GO:0006355	0.403	regulation of DNA-templated transcription
GO:0051172	0.397	negative regulation of nitrogen compound metabolic process
GO:0031324	0.349	negative regulation of cellular metabolic process
GO:0045892	0.313	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0005634	0.960	nucleus
GO:0005737	0.950	cytoplasm
GO:0005576	0.887	extracellular region
GO:0031982	0.876	vesicle
GO:0043228	0.873	non-membrane-bounded organelle
GO:0043232	0.863	intracellular non-membrane-bounded organelle
GO:0043230	0.861	extracellular organelle
GO:1903561	0.852	extracellular vesicle
GO:0070062	0.839	extracellular exosome
GO:0016020	0.654	membrane
GO:0015629	0.616	actin cytoskeleton
GO:0005829	0.470	cytosol
GO:0043209	0.385	myelin sheath

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]