StarFunc result for job id Q9UI17

User Input

>input (866 residues)
MLRPGAQLLRGLLLRSCPLQGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCV
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYLIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAAGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMR
ANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVKALKRELPVLRDLEGSYYL
RQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDRIMEHIKAAMEMVPVLK
KADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVAVTDLSPFGKF
NIKGQDSIRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTK
SLKVSNIPVTAIRISYTGELGWELYHRREDSVALYDAIMNAGQEEGIDNFGTYAMNALRL
EKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATD
DVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPA
VIIQEPLVLTEPTRNRLQKKGGKDKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pabB	0.946	0.995	0.000	824	0.879	0.924	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
2	AFDB:Q9DBT9	0.968	0.965	0.000	869	0.898	0.895	Q9DBT9.pdb.gz	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
3	AFDB:Q9UI17	1.000	1.000	0.000	866	1.000	1.000	Q9UI17.pdb.gz	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
4	AFDB:Q9UL12	0.882	0.833	2.584E-82	918	0.334	0.315	Q9UL12.pdb.gz	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
5	AFDB:Q64380	0.884	0.834	2.506E-81	919	0.327	0.308	Q64380.pdb.gz	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
6	AFDB:Q8NCN5	0.884	0.871	1.810E-77	879	0.299	0.295	Q8NCN5.pdb.gz	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
7	AFDB:Q8IGS5	0.870	0.832	1.587E-76	907	0.297	0.283	Q8IGS5.pdb.gz	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
8	AFDB:Q9HTE6	0.413	0.357	1.254E-34	1005	0.177	0.152	Q9HTE6.pdb.gz	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
9	AFDB:P25285	0.402	0.853	7.787E-31	397	0.114	0.249	P25285.pdb.gz	GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus OX=9913 GN=AMT PE=1 SV=1
10	AFDB:P49364	0.400	0.833	1.501E-30	408	0.113	0.240	P49364.pdb.gz	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
11	AFDB:Q8CFA2	0.399	0.839	1.837E-30	403	0.111	0.238	Q8CFA2.pdb.gz	GCST_MOUSE Aminomethyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Amt PE=1 SV=1
12	PDB:1wsvA	0.394	0.899	3.484E-30	371	0.111	0.259	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
13	PDB:1vloA	0.376	0.866	3.887E-27	364	0.105	0.250	1vloA.pdb.gz
14	PDB:4yshA	0.379	0.833	6.567E-26	370	0.111	0.259	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
15	PDB:3if9A	0.358	0.808	1.457E-23	364	0.098	0.234	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
16	PDB:3nycA	0.362	0.771	4.288E-22	381	0.090	0.205	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
17	PDB:2uzzB	0.373	0.816	2.244E-19	372	0.085	0.199	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
18	PDB:3awiD	0.350	0.450	1.849E-16	659	0.088	0.115	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
19	PDB:5oc2A	0.358	0.645	6.532E-16	441	0.083	0.163	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.
20	PDB:1nrkA	0.308	0.754	1.738E-14	325	0.066	0.175	1nrkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63342	0.0	1620	857	0.906	0.916	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
2	Q8TCC6	0.0	1224	613	0.680	0.961	Q8TCC6_HUMAN DMGDH protein (Fragment) OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=1
3	Q9DBT9	0.0	1610	869	0.897	0.894	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
4	Q9UI17	0.0	1790	866	1.000	1.000	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
5	Q9UL12	5.14e-140	440	918	0.323	0.305	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
6	Q64380	1.84e-138	436	919	0.323	0.305	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
7	Q99LB7	7.97e-138	434	919	0.321	0.303	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
8	A1ZAZ2	8.77e-120	386	894	0.306	0.296	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1
9	Q8IGS5	3.90e-119	385	907	0.306	0.292	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
10	Q8NCN5	1.67e-104	345	879	0.298	0.294	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
11	Q7TSQ8	1.06e-101	338	878	0.296	0.292	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
12	O96023	1.81e-68	237	475	0.164	0.299	O96023_HUMAN Dimethylglycine dehydrogenase-like protein isoform 2 OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q961K2	5.88e-64	228	600	0.189	0.273	Q961K2_DROME GH19226p OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
14	Q9UL11	2.44e-48	176	328	0.114	0.302	Q9UL11_HUMAN Uncharacterized protein SARDH (Fragment) OS=Homo sapiens OX=9606 GN=SARDH PE=2 SV=1
15	Q9UL10	2.89e-41	158	396	0.104	0.227	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
16	Q9HTE6	9.63e-32	135	1005	0.112	0.097	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
17	Q5JFG7	3.22e-26	114	386	0.117	0.262	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
18	P9WN51	4.27e-24	107	367	0.107	0.253	GCST_MYCTU Aminomethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gcvT PE=1 SV=1
19	P49364	7.32e-23	104	408	0.117	0.248	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
20	O65396	3.12e-22	102	408	0.113	0.240	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02558 ApbA	69	14.5	Ketopantoate reductase PanE/ApbA
2	PF01266 DAO	7.3e-58	208.4	FAD dependent oxidoreductase
3	PF00890 FAD_binding_2	1.2	19.8	FAD binding domain
4	PF01494 FAD_binding_3	9.1	17.0	FAD binding domain
5	PF16350 FAO_M	6.8e-10	50.4	FAD dependent oxidoreductase central domain
6	PF01571 GCV_T	2.2e-60	215.7	Aminomethyltransferase folate-binding domain
7	PF08669 GCV_T_C	1.2e-17	74.8	Glycine cleavage T-protein C-terminal barrel domain
8	PF03486 HI0933_like	3.3e+02	11.4	HI0933-like protein
9	PF05834 Lycopene_cycl	4.1e+02	11.4	Lycopene cyclase protein
10	PF13241 NAD_binding_7	5e+02	12.5	Putative NAD(P)-binding
11	PF13450 NAD_binding_8	0.86	21.2	NAD(P)-binding Rossmann-like domain
12	PF13454 NAD_binding_9	16	17.0	FAD-NAD(P)-binding
13	PF00070 Pyr_redox	69	15.4	Pyridine nucleotide-disulphide oxidoreductase
14	PF07992 Pyr_redox_2	1.1	20.0	Pyridine nucleotide-disulphide oxidoreductase
15	PF13738 Pyr_redox_3	0.0014	29.5	Pyridine nucleotide-disulphide oxidoreductase
16	PF04268 SoxG	67	15.0	Sarcosine oxidase, gamma subunit family
17	PF01946 Thi4	9.2	17.0	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255189

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361894	0.985	Glycine N-methyltransferase
2	9606.ENSP00000274353	0.982	Betaine--homocysteine S-methyltransferase 1
3	9606.ENSP00000317721	0.945	Peroxisomal sarcosine oxidase
4	9606.ENSP00000360938	0.926	Sarcosine dehydrogenase, mitochondrial
5	9606.ENSP00000370737	0.851	Glycine dehydrogenase (decarboxylating), mitochondrial
6	9606.ENSP00000333667	0.825	Serine hydroxymethyltransferase, mitochondrial
7	9606.ENSP00000318868	0.805	Serine hydroxymethyltransferase, cytosolic
8	9606.ENSP00000319531	0.791	Glycine cleavage system H protein, mitochondrial
9	9606.ENSP00000367299	0.788	Vacuolar protein-sorting-associated protein 36
10	9606.ENSP00000365777	0.781	Methylenetetrahydrofolate reductase
11	9606.ENSP00000264668	0.760	Methionine synthase reductase
12	9606.ENSP00000255192	0.753	S-methylmethionine--homocysteine S-methyltransferase BHMT2
13	9606.ENSP00000236959	0.736	Bifunctional purine biosynthesis protein PURH
14	9606.ENSP00000378854	0.734	Phosphoserine phosphatase
15	9606.ENSP00000258874	0.728	5-formyltetrahydrofolate cyclo-ligase
16	9606.ENSP00000418397	0.707	Isovaleryl-CoA dehydrogenase, mitochondrial
17	9606.ENSP00000358417	0.706	D-3-phosphoglycerate dehydrogenase
18	9606.ENSP00000319851	0.698	Choline dehydrogenase, mitochondrial
19	9606.ENSP00000455643	0.685	5-formyltetrahydrofolate cyclo-ligase
20	9606.ENSP00000399136	0.668	Sodium- and chloride-dependent betaine transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	1.000	heterocyclic compound binding
GO:0097159	1.000	organic cyclic compound binding
GO:0046997	1.000	oxidoreductase activity, acting on the CH-NH group of donors, flavin as acceptor
GO:0043168	0.990	anion binding
GO:0036094	0.988	small molecule binding
GO:0050660	0.973	flavin adenine dinucleotide binding
GO:0031406	0.917	carboxylic acid binding
GO:0072341	0.910	modified amino acid binding
GO:0019842	0.909	vitamin binding
GO:0005542	0.899	folic acid binding
GO:0003676	0.871	nucleic acid binding
GO:0047865	0.861	dimethylglycine dehydrogenase activity
GO:0003723	0.842	RNA binding
GO:0005515	0.389	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.994	organonitrogen compound metabolic process
GO:0097164	0.989	ammonium ion metabolic process
GO:0009308	0.975	amine metabolic process
GO:0042402	0.974	cellular biogenic amine catabolic process
GO:0044237	0.959	cellular metabolic process
GO:0044281	0.838	small molecule metabolic process
GO:0006575	0.731	cellular modified amino acid metabolic process
GO:0044238	0.458	primary metabolic process
GO:1901360	0.421	organic cyclic compound metabolic process
GO:0046483	0.411	heterocycle metabolic process
GO:0006725	0.402	cellular aromatic compound metabolic process
GO:0043436	0.356	oxoacid metabolic process
GO:0006760	0.311	folic acid-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.993	intracellular organelle lumen
GO:0005759	0.765	mitochondrial matrix
GO:0005829	0.435	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.8.-	1.000	With a flavin as acceptor.
RHEA:52856	0.861	(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + H(+) + N,N-dimethylglycine + oxidized [electron-transfer flavoprotein] = (6R)-5,10-methylenetetrahydrofolyl-(gamma-L-Glu)(n) + reduced [electron-transfer flavoprotein] + sarcosine
EC:1.5.8.4	0.861	dimethylglycine dehydrogenase.

[back to server]