StarFunc result for job id Q9UI26

User Input

>input (975 residues)
MDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFTNHTLDINVRW
LAVLYFKHGIDRYWRRVAPHALSEEEKTTLRAGLITNFNEPINQIATQIAVLIAKVARLD
CPRQWPELIPTLIESVKVQDDLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNF
ACSLWNHHTDTFLQEVSSGNEAAILSSLERTLLSLKVLRKLTVNGFVEPHKNMEVMGFLH
GIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDFLDQHPFSFTPLIQRSLEFSV
SYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFEDSSPETLEAHKIKMAFFTYP
TLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEY
NQTLTPVLLEMMQTLQGPTNVEDMNALLIKDAVYNAVGLAAYELFDSVDFDQWFKNQLLP
ELQVIHNRYKPLRRRVIWLIGQWISVKFKSDLRPMLYEAICNLLQDQDLVVRIETATTLK
LTVDDFEFRTDQFLPYLETMFTLLFQLLQQVTECDTKMHVLHVLSCVIERVNMQIRPYVG
CLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQGLGADSKNLYPFLLPVIQLSTDVSQPPH
VYLLEDGLELWLVTLENSPCITPELLRIFQNMSPLLELSSENLRTCFKIINGYIFLSSTE
FLQTYAVGLCQSFCELLKEITTEGQVQVLKVVENALKVNPILGPQMFQPILPYVFKGIIE
GERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNIT
QPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHL
EEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETV
DTEIVTQLQEFLQGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K2V6	0.999	0.999	0.000	975	0.968	0.968	Q8K2V6.pdb.gz	IPO11_MOUSE Importin-11 OS=Mus musculus OX=10090 GN=Ipo11 PE=1 SV=1
2	AFDB:Q02932	0.886	0.840	3.377E-37	1032	0.268	0.253	Q02932.pdb.gz	KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP120 PE=1 SV=1
3	AFDB:O94545	0.863	0.856	1.566E-35	983	0.230	0.228	O94545.pdb.gz	KA113_SCHPO Importin beta-like protein kap113 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap113 PE=3 SV=1
4	PDB:6fvbA	0.851	0.831	1.633E-30	1001	0.268	0.261	6fvbA.pdb.gz
5	AFDB:Q7KIF8	0.660	0.620	3.987E-21	1049	0.164	0.153	Q7KIF8.pdb.gz	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
6	AFDB:F4IRR2	0.773	0.729	1.059E-20	1040	0.179	0.168	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
7	AFDB:O59809	0.736	0.701	4.913E-20	1029	0.164	0.155	O59809.pdb.gz	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
8	AFDB:O42480	0.665	0.630	5.268E-20	1038	0.173	0.163	O42480.pdb.gz	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
9	AFDB:A0A384NKW7	0.591	0.593	2.360E-19	971	0.170	0.171	A0A384NKW7.pdb.gz	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
10	AFDB:O15397	0.704	0.667	6.491E-19	1037	0.176	0.166	O15397.pdb.gz	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
11	AFDB:Q91YE6	0.547	0.521	8.002E-19	1041	0.165	0.155	Q91YE6.pdb.gz	IPO9_MOUSE Importin-9 OS=Mus musculus OX=10090 GN=Ipo9 PE=1 SV=3
12	PDB:6n1zA	0.559	0.566	5.131E-18	961	0.169	0.172	6n1zA.pdb.gz
13	PDB:1wa5C	0.634	0.649	2.935E-17	950	0.150	0.154	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
14	PDB:1z3hB	0.532	0.559	3.742E-15	914	0.149	0.159	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
15	PDB:4jlqA	0.481	0.545	2.830E-14	840	0.125	0.145	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:6ahoA	0.557	0.585	1.267E-12	916	0.159	0.169	6ahoA.pdb.gz
17	PDB:6xu2A	0.466	0.425	1.267E-12	1091	0.143	0.127	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
18	PDB:3nd2A	0.435	0.483	4.147E-11	861	0.129	0.146	3nd2A.pdb.gz
19	PDB:3w3uA	0.484	0.461	4.937E-11	1030	0.141	0.133	3w3uA.pdb.gz
20	PDB:2xwuB	0.391	0.413	1.223E-10	910	0.120	0.129	2xwuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K2V6	0.0	1954	975	0.968	0.968	IPO11_MOUSE Importin-11 OS=Mus musculus OX=10090 GN=Ipo11 PE=1 SV=1
2	Q9UI26	0.0	2014	975	1.000	1.000	IPO11_HUMAN Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1
3	Q02932	2.14e-81	287	1032	0.283	0.267	KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP120 PE=1 SV=1
4	O94545	7.04e-74	265	983	0.249	0.247	KA113_SCHPO Importin beta-like protein kap113 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap113 PE=3 SV=1
5	O13671	1.25e-10	68.2	967	0.044	0.044	CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap109 PE=3 SV=2
6	P33307	6.06e-10	65.9	960	0.114	0.116	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2
7	Q9FJD4	3.04e-09	63.5	870	0.048	0.054	IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana OX=3702 GN=KPNB1 PE=1 SV=1
8	Q04175	7.48e-09	62.4	944	0.030	0.031	SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SXM1 PE=1 SV=1
9	Q91YE6	8.14e-09	62.4	1041	0.114	0.107	IPO9_MOUSE Importin-9 OS=Mus musculus OX=10090 GN=Ipo9 PE=1 SV=3
10	Q96P70	8.21e-09	62.0	1041	0.114	0.107	IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3
11	Q9VGP4	2.24e-08	60.8	1018	0.037	0.035	IPO9_DROME Importin-9 OS=Drosophila melanogaster OX=7227 GN=Ipo9 PE=2 SV=1
12	Q7KIF8	3.07e-08	60.5	1049	0.038	0.035	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
13	Q7SZC2	3.32e-08	60.1	971	0.041	0.041	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
14	Q9VSD6	3.34e-08	60.1	1049	0.038	0.035	Q9VSD6_DROME D-Importin 7/RanBP7 OS=Drosophila melanogaster OX=7227 GN=msk PE=1 SV=1
15	Q86NK4	3.37e-08	60.1	1049	0.038	0.035	Q86NK4_DROME GH01576p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
16	Q9XZU1	4.40e-08	59.7	975	0.035	0.035	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
17	Q9EPL8	3.75e-07	56.6	1038	0.038	0.036	IPO7_MOUSE Importin-7 OS=Mus musculus OX=10090 GN=Ipo7 PE=1 SV=2
18	O95373	9.39e-07	55.5	1038	0.037	0.035	IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1
19	O42480	1.90e-06	54.3	1038	0.039	0.037	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
20	Q9ERK4	9.14e-06	52.4	971	0.039	0.039	XPO2_MOUSE Exportin-2 OS=Mus musculus OX=10090 GN=Cse1l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07560 DUF1539	3e+02	12.9	Domain of Unknown Function (DUF1539)
2	PF02985 HEAT	3.4e+02	12.9	HEAT repeat
3	PF13646 HEAT_2	25	16.7	HEAT repeats
4	PF06825 HSBP1	8.2e+02	11.3	Heat shock factor binding protein 1
5	PF03810 IBN_N	5.1e-16	69.7	Importin-beta N-terminal domain
6	PF08167 RIX1	2.5e+02	12.8	rRNA processing/ribosome biogenesis
7	PF08389 Xpo1	1.1e+02	14.2	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386788	0.934	Ubiquitin-conjugating enzyme E2 E3
2	9606.ENSP00000261574	0.923	Importin-5
3	9606.ENSP00000446215	0.919	GTP-binding nuclear protein Ran
4	9606.ENSP00000346453	0.906	Importin-4
5	9606.ENSP00000290158	0.895	Importin subunit beta-1
6	9606.ENSP00000354739	0.890	60S ribosomal protein L12
7	9606.ENSP00000361418	0.846	Importin-13
8	9606.ENSP00000384863	0.841	Exportin-1
9	9606.ENSP00000303709	0.829	Ubiquitin-conjugating enzyme E2 E1
10	9606.ENSP00000265388	0.826	Transportin-3
11	9606.ENSP00000256079	0.766	Importin-8
12	9606.ENSP00000399441	0.764	Leucine-rich repeat-containing protein 70
13	9606.ENSP00000389103	0.761	60S ribosomal protein L23a
14	9606.ENSP00000336712	0.757	Transportin-1
15	9606.ENSP00000407182	0.737	Transportin-2
16	9606.ENSP00000259569	0.732	Ran-binding protein 6
17	9606.ENSP00000436679	0.724	Nuclear RNA export factor 1
18	9606.ENSP00000265351	0.715	Exportin-5
19	9606.ENSP00000379931	0.702	Ubiquitin-conjugating enzyme E2 E2
20	9606.ENSP00000255305	0.695	Exportin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140142	0.997	nucleocytoplasmic carrier activity
GO:0061608	0.994	nuclear import signal receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006606	0.993	protein import into nucleus
GO:0050789	0.331	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.919	protein-containing complex
GO:0005635	0.459	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]