StarFunc result for job id Q9UI33

User Input

>input (1791 residues)
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKKSKDQTGEVPQPRPQLDLKASR
KLPKLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNRKRTIYRFSAKHALFIFGPFNSIRS
LAIRVSVHSLFSMFIIGTVIINCVFMATGPAKNSNSNNTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSYIPGITIKLLPLRTFRVFRALKAISVVSRLK
VIVGALLRSVKKLVNVIILTFFCLSIFALVGQQLFMGSLNLKCISRDCKNISNPEAYDHC
FEKKENSPEFKMCGIWMGNSACSIQYECKHTKINPDYNYTNFDNFGWSFLAMFRLMTQDS
WEKLYQQTLRTTGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKM
FQEAQQLLKEEKEALVAMGIDRSSLTSLETSYFTPKKRKLFGNKKRKSFFLRESGKDQPP
GSDSDEDCQKKPQLLEQTKRLSQNLSLDHFDEHGDPLQRQRALSAVSILTITMKEQEKSQ
EPCLPCGENLASKYLVWNCCPQWLCVKKVLRTVMTDPFTELAITICIIINTVFLAMEHHK
MEASFEKMLNIGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNCV
LQKRSWPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGM
QLFGRSFNSQKSPKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEA
NASSSLCVIVFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGEARKTKVQLALDRFR
RAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGIL
TSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQR
VQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLP
KGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVHL
ENQPKIQELLNCTDIIFTHIFILEMVLKWVAFGFGKYFTSAWCCLDFIIVIVSVTTLINL
MELKSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLVFCILGVYFF
SGKFGKCINGTDSVINYTIITNKSQCESGNFSWINQKVNFDNVGNAYLALLQVATFKGWM
DIIYAAVDSTEKEQQPEFESNSLGYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGG
QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDIVTSQIFDIIIISLIILNM
ISMMAESYNQPKAMKSILDHLNWVFVVIFTLECLIKIFALRQYYFTNGWNLFDCVVVLLS
IVSTMISTLENQEHIPFPPTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNI
GLLLFLIMFIYAILGMNWFSKVNPESGIDDIFNFKTFASSMLCLFQISTSAGWDSLLSPM
LRSKESCNSSSENCHLPGIATSYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGE
DDFDIFYEVWEKFDPEATQFIKYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSEDRL
HCMDILFAFTARVLGGSDGLDSMKAMMEEKFMEANPLKKLYEPIVTTTKRKEEERGAAII
QKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7w9lA	0.684	0.855	0.000	1420	0.469	0.592	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
2	AFDB:A0A0R4IUM7	0.804	0.739	0.000	1955	0.507	0.464	A0A0R4IUM7.pdb.gz	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	AFDB:A2APX8	0.811	0.725	0.000	2009	0.510	0.454	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
4	AFDB:F1QXF5	0.807	0.726	0.000	1996	0.515	0.462	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
5	AFDB:O88457	0.883	0.896	0.000	1765	0.733	0.744	O88457.pdb.gz	SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn11a PE=1 SV=1
6	AFDB:P15389	0.807	0.719	0.000	2019	0.547	0.485	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
7	AFDB:Q9R053	0.899	0.912	0.000	1765	0.726	0.737	Q9R053.pdb.gz	SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus OX=10090 GN=Scn11a PE=1 SV=2
8	AFDB:Q9UI33	1.000	1.000	0.000	1791	1.000	1.000	Q9UI33.pdb.gz	SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens OX=9606 GN=SCN11A PE=1 SV=2
9	AFDB:Q9Y5Y9	0.809	0.743	0.000	1956	0.542	0.496	Q9Y5Y9.pdb.gz	SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens OX=9606 GN=SCN10A PE=1 SV=2
10	PDB:7xveA	0.631	0.870	6.924E-101	1276	0.414	0.581	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
11	PDB:7we4A	0.584	0.921	7.646E-88	1122	0.382	0.611	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
12	PDB:6j8gA	0.592	0.921	1.472E-84	1140	0.385	0.604	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
13	PDB:6j8eA	0.592	0.921	2.950E-84	1139	0.383	0.602	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
14	PDB:6agfA	0.588	0.915	1.541E-81	1138	0.386	0.607	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
15	PDB:6lqaB	0.598	0.922	7.055E-81	1151	0.394	0.613	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
16	PDB:6uz3A	0.587	0.922	1.001E-78	1126	0.386	0.614	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
17	PDB:7tj9A	0.580	0.924	2.207E-69	1111	0.284	0.458	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
18	PDB:7vfsA	0.560	0.776	5.354E-51	1266	0.200	0.284	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
19	AFDB:Q91ZR5	0.126	0.313	1.779E-4	686	0.066	0.172	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
20	AFDB:Q9FMF9	0.057	0.071	4.843E-2	1269	0.059	0.083	Q9FMF9.pdb.gz	Q9FMF9_ARATH Nuclear protein-like OS=Arabidopsis thaliana OX=3702 GN=MSJ1.11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	1368	1962	0.407	0.372	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	1265	1955	0.381	0.349	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	869	1618	0.276	0.306	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	1264	1998	0.385	0.345	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	676	1915	0.184	0.172	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	1263	1997	0.385	0.346	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	1206	1939	0.373	0.345	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	991	1672	0.356	0.381	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	1273	2009	0.384	0.342	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	1284	1947	0.393	0.362	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	1293	2006	0.395	0.353	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1092	1681	0.373	0.397	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	983	1998	0.276	0.248	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	967	1983	0.273	0.247	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	826	1680	0.269	0.287	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	1316	1996	0.396	0.355	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	1025	2016	0.285	0.253	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	1368	1962	0.407	0.372	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	1288	1984	0.397	0.358	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	1265	1978	0.383	0.347	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	2.9	19.2	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00520 Ion_trans	1.3e-241	809.0	Ion transport protein
3	PF06512 Na_trans_assoc	2e-41	154.1	Sodium ion transport-associated
4	PF08016 PKD_channel	1.6e-11	55.6	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322460	0.832	Sodium channel subunit beta-4
2	9606.ENSP00000396915	0.811	Sodium channel subunit beta-1
3	9606.ENSP00000389843	0.770	Sodium-coupled neutral amino acid transporter 4
4	9606.ENSP00000481301	0.766	Sodium-coupled neutral amino acid transporter 3
5	9606.ENSP00000256689	0.764	Sodium-coupled neutral amino acid transporter 2
6	9606.ENSP00000449756	0.764	Sodium-coupled neutral amino acid transporter 1
7	9606.ENSP00000471683	0.764	Sodium-coupled neutral amino acid transporter 5
8	9606.ENSP00000278947	0.760	Sodium channel subunit beta-2
9	9606.ENSP00000376523	0.740	Sodium channel subunit beta-3
10	9606.ENSP00000368314	0.737	Neuronal cell adhesion molecule
11	9606.ENSP00000356265	0.733	Neuron navigator 1
12	9606.ENSP00000280772	0.729	Ankyrin-3
13	9606.ENSP00000346534	0.726	Sodium channel protein type 8 subunit alpha
14	9606.ENSP00000352035	0.712	Potassium voltage-gated channel subfamily KQT member 2
15	9606.ENSP00000265709	0.707	Ankyrin-1
16	9606.ENSP00000413496	0.707	Fibroblast growth factor 12
17	9606.ENSP00000459962	0.707	Transient receptor potential cation channel, subfamily V, member 1
18	9606.ENSP00000461007	0.707	Transient receptor potential cation channel subfamily V member 1
19	9606.ENSP00000303540	0.701	Sodium channel protein type 1 subunit alpha
20	9606.ENSP00000386306	0.698	Sodium channel protein type 9 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.995	protein binding
GO:0022836	0.768	gated channel activity
GO:0022839	0.749	monoatomic ion gated channel activity
GO:0005244	0.491	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0006811	0.991	monoatomic ion transport
GO:0006814	0.968	sodium ion transport
GO:0050896	0.913	response to stimulus
GO:0009987	0.858	cellular process
GO:0065007	0.713	biological regulation
GO:0042221	0.612	response to chemical
GO:0032501	0.609	multicellular organismal process
GO:0055085	0.479	transmembrane transport
GO:0050789	0.374	regulation of biological process
GO:0009410	0.347	response to xenobiotic stimulus
GO:0050794	0.343	regulation of cellular process
GO:0065008	0.316	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.978	membrane-bounded organelle
GO:0032991	0.954	protein-containing complex
GO:0042995	0.886	cell projection
GO:0120025	0.820	plasma membrane bounded cell projection
GO:0005576	0.789	extracellular region
GO:0005622	0.701	intracellular anatomical structure
GO:0043229	0.577	intracellular organelle
GO:0098796	0.520	membrane protein complex
GO:0098797	0.443	plasma membrane protein complex
GO:0034703	0.414	cation channel complex
GO:0070062	0.330	extracellular exosome
GO:0012505	0.304	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]