StarFunc result for job id Q9UI36

User Input

>input (758 residues)
MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPI
ASAAAAAATVTSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGG
GISAGGGVASSTPINASTGSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVE
NTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITP
VVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKRTQSVTSPE
NSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNN
QHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQ
QSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVE
TSVIKERVPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMN
QMLMGLSPNVLPGPKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQP
LPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLREREL
RETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLR
VLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UI36	1.000	1.000	0.000	758	1.000	1.000	Q9UI36.pdb.gz	DACH1_HUMAN Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4
2	AFDB:B3DJL7	0.272	0.340	6.685E-40	567	0.388	0.519	B3DJL7.pdb.gz
3	AFDB:H2KY91	0.143	0.255	2.043E-16	420	0.140	0.252	H2KY91.pdb.gz	DAC1_CAEEL Dachshund homolog dac-1 OS=Caenorhabditis elegans OX=6239 GN=dac-1 PE=2 SV=1
4	AFDB:B3G3K1	0.055	0.068	1.297E-3	584	0.149	0.193	B3G3K1.pdb.gz	B3G3K1_ANCCA Forkhead transcription factor DAF-16 OS=Ancylostoma caninum OX=29170 GN=daf16 PE=2 SV=1
5	AFDB:P36011	0.079	0.091	1.858E-2	622	0.129	0.158	P36011.pdb.gz	STUA_EMENI Cell pattern formation-associated protein stuA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stuA PE=1 SV=2
6	AFDB:E9PNV5	0.068	0.064	2.719E-2	815	0.179	0.167	E9PNV5.pdb.gz	E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=8
7	AFDB:Q56UE1	0.066	0.075	5.817E-2	643	0.137	0.162	Q56UE1.pdb.gz	Q56UE1_EMEND NSDC OS=Emericella nidulans OX=162425 GN=nsdC PE=4 SV=1
8	AFDB:O13695	0.045	0.057	8.510E-2	536	0.131	0.185	O13695.pdb.gz	YEN1_SCHPO Uncharacterized serine-rich protein C11G7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11G7.01 PE=4 SV=1
9	AFDB:Q5AS72	0.055	0.057	1.029E-1	717	0.139	0.146	Q5AS72.pdb.gz	Q5AS72_EMENI Forkhead transcription factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08858 PE=4 SV=1
10	AFDB:E7F981	0.060	0.029	1.168E-1	1814	0.102	0.042	E7F981.pdb.gz	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
11	PDB:6lthM	0.087	0.230	1.267	259	0.021	0.062	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
12	PDB:6pwnA	0.053	0.112	2.388	280	0.020	0.054	6pwnA.pdb.gz
13	PDB:3szpA	0.028	0.060	2.711	290	0.011	0.028	3szpA.pdb.gz
14	PDB:4zzlA	0.033	0.122	3.493	146	0.011	0.055	4zzlA.pdb.gz
15	PDB:6xmtA	0.031	0.022	3.493	1092	0.009	0.006	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
16	PDB:7nfxy	0.046	0.173	3.493	147	0.016	0.082	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
17	PDB:8dksA	0.050	0.101	3.493	283	0.016	0.042	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:2pjdA	0.019	0.042	4.502	334	0.015	0.033	2pjdA.pdb.gz
19	PDB:7edxT	0.028	0.152	4.796	113	0.007	0.044	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:3zqqC	0.039	0.113	5.110	134	0.017	0.097	3zqqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L2G2	0.0	856	611	0.633	0.786	A1L2G2_DANRE Dachshund homolog 1 OS=Danio rerio OX=7955 GN=zgc:158869 PE=2 SV=1
2	F1R0U6	0.0	632	602	0.474	0.596	F1R0U6_DANRE Dachshund a OS=Danio rerio OX=7955 GN=cb907 PE=4 SV=1
3	Q925Q8	0.0	598	634	0.455	0.544	DACH2_MOUSE Dachshund homolog 2 OS=Mus musculus OX=10090 GN=Dach2 PE=1 SV=1
4	Q9QYB2	0.0	1130	751	0.942	0.951	DACH1_MOUSE Dachshund homolog 1 OS=Mus musculus OX=10090 GN=Dach1 PE=1 SV=1
5	Q9UI36	0.0	1521	758	1.000	1.000	DACH1_HUMAN Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4
6	Q24029	1.21e-52	200	1065	0.115	0.082	Q24029_DROME Dachshund variant 4 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
7	Q8IP21	1.24e-52	199	1065	0.115	0.082	Q8IP21_DROME Dachshund, isoform C OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
8	Q6NR49	2.13e-50	181	321	0.106	0.249	Q6NR49_DROME AT14140p OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
9	Q9VJK6	2.37e-50	193	1072	0.115	0.081	Q9VJK6_DROME Dachshund, isoform A OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=3
10	Q24031	2.55e-50	192	1072	0.115	0.081	Q24031_DROME Dachshund variant 3 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
11	Q59DZ0	3.84e-50	192	1063	0.112	0.080	Q59DZ0_DROME Dachshund, isoform G OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
12	Q8IP20	4.89e-50	192	1074	0.115	0.081	Q8IP20_DROME Dachshund, isoform D OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
13	Q24028	5.03e-50	192	1074	0.115	0.081	Q24028_DROME Dachshund variant 1 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
14	F1R4Z6	1.32e-49	185	567	0.121	0.162	F1R4Z6_DANRE Dachshund b OS=Danio rerio OX=7955 GN=zgc:136530 PE=4 SV=1
15	Q59DY9	2.80e-49	189	1072	0.112	0.079	Q59DY9_DROME Dachshund, isoform F OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
16	Q24027	2.83e-49	189	1072	0.112	0.079	Q24027_DROME Dachshund variant 2 OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
17	Q8IP19	4.10e-49	189	1081	0.115	0.080	Q8IP19_DROME Dachshund, isoform B OS=Drosophila melanogaster OX=7227 GN=dac PE=4 SV=1
18	Q24030	4.14e-49	189	1081	0.115	0.080	Q24030_DROME Dachshund OS=Drosophila melanogaster OX=7227 GN=dac PE=2 SV=1
19	H2KY91	1.02e-44	168	420	0.106	0.190	DAC1_CAEEL Dachshund homolog dac-1 OS=Caenorhabditis elegans OX=6239 GN=dac-1 PE=2 SV=1
20	Q8IDX6	5.47e-06	52.8	3130	0.044	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02437 Ski_Sno	2.5e-37	138.2	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000010068

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000031782	0.914	Eyes absent homolog
2	9598.ENSPTRP00000042753	0.890	Uncharacterized protein
3	9598.ENSPTRP00000034805	0.888	Eyes absent homolog
4	9598.ENSPTRP00000060033	0.804	Jun proto-oncogene, AP-1 transcription factor subunit
5	9598.ENSPTRP00000057584	0.745	Uncharacterized protein
6	9598.ENSPTRP00000039172	0.739	Distal-less homeobox 1
7	9598.ENSPTRP00000010878	0.723	SIX homeobox 1
8	9598.ENSPTRP00000017047	0.722	Mothers against decapentaplegic homolog
9	9598.ENSPTRP00000036650	0.711	SET nuclear oncogene
10	9598.ENSPTRP00000014836	0.693	Cellular tumor antigen p53
11	9598.ENSPTRP00000023365	0.659	Eyes absent homolog
12	9598.ENSPTRP00000032656	0.655	Has a dual function as a transcriptional activator and a repressor of the sonic hedgehog (Shh) pathway, and plays a role in limb development. The full-length GLI3 form (GLI3FL) after phosphorylation and nuclear translocation, acts as an activator (GLI3A) while GLI3R, its C-terminally truncated form, acts as a repressor. A proper balance between the GLI3 activator and the repressor GLI3R, rather than the repressor gradient itself or the activator/repressor ratio gradient, specifies limb digit number and identity. In concert with TRPS1, plays a role in regulating the size of the zone of [...]
13	9598.ENSPTRP00000020407	0.622	Uncharacterized protein
14	9598.ENSPTRP00000000739	0.620	Eyes absent homolog
15	9598.ENSPTRP00000028672	0.620	Uncharacterized protein
16	9598.ENSPTRP00000020406	0.619	Uncharacterized protein
17	9598.ENSPTRP00000012969	0.606	Ubiquitin-conjugating enzyme E2I
18	9598.ENSPTRP00000060886	0.594	Uncharacterized protein
19	9598.ENSPTRP00000014683	0.587	Proline, glutamate and leucine rich protein 1
20	9598.ENSPTRP00000000760	0.584	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.996	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0048519	0.966	negative regulation of biological process
GO:0048523	0.949	negative regulation of cellular process
GO:0006357	0.932	regulation of transcription by RNA polymerase II
GO:0032501	0.929	multicellular organismal process
GO:0009892	0.917	negative regulation of metabolic process
GO:0032502	0.905	developmental process
GO:0048856	0.900	anatomical structure development
GO:0010605	0.899	negative regulation of macromolecule metabolic process
GO:0045892	0.854	negative regulation of DNA-templated transcription
GO:0000122	0.823	negative regulation of transcription by RNA polymerase II
GO:0007275	0.798	multicellular organism development
GO:0009987	0.642	cellular process
GO:0048513	0.540	animal organ development
GO:0050896	0.417	response to stimulus
GO:0048731	0.415	system development
GO:0048518	0.321	positive regulation of biological process
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.970	cytoplasm
GO:0070013	0.945	intracellular organelle lumen
GO:0031981	0.942	nuclear lumen
GO:0005654	0.931	nucleoplasm
GO:0032991	0.924	protein-containing complex
GO:0005667	0.848	transcription regulator complex
GO:0012505	0.780	endomembrane system
GO:0005829	0.746	cytosol
GO:0005794	0.424	Golgi apparatus
GO:0016604	0.421	nuclear body
GO:0016607	0.413	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]