StarFunc result for job id Q9UI43

User Input

>input (246 residues)
MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKL
LEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLE
GATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSV
TPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGR
KGTVKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UI43	1.000	1.000	1.102E-53	246	1.000	1.000	Q9UI43.pdb.gz	MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1
2	AFDB:Q9CPY0	0.889	0.889	4.495E-46	246	0.789	0.789	Q9CPY0.pdb.gz	MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Mrm2 PE=1 SV=1
3	PDB:7o9mn	0.855	0.976	7.351E-42	215	0.874	1.000	7o9mn.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
4	AFDB:Q9VDT6	0.864	0.851	1.099E-28	250	0.390	0.384	Q9VDT6.pdb.gz	MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG11447 PE=2 SV=1
5	AFDB:P0C0R7	0.798	0.934	2.219E-24	209	0.293	0.344	P0C0R7.pdb.gz	RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) OX=83333 GN=rlmE PE=1 SV=1
6	AFDB:P53123	0.758	0.589	5.095E-22	320	0.346	0.266	P53123.pdb.gz	MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM2 PE=1 SV=1
7	AFDB:Q586Q7	0.772	0.217	1.418E-21	905	0.268	0.073	Q586Q7.pdb.gz	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
8	AFDB:P78860	0.748	0.841	2.365E-21	218	0.309	0.349	P78860.pdb.gz	MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm2 PE=2 SV=2
9	AFDB:Q9VDD9	0.776	0.601	3.054E-21	320	0.305	0.234	Q9VDD9.pdb.gz	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
10	AFDB:F4JTD2	0.754	0.230	1.611E-20	821	0.232	0.069	F4JTD2.pdb.gz	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
11	AFDB:Q8IY81	0.730	0.218	1.952E-20	847	0.289	0.084	Q8IY81.pdb.gz	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
12	PDB:6jplB	0.759	0.806	1.390E-19	231	0.305	0.325	6jplB.pdb.gz	Structure of tRNA methyltransferase complex of Trm7 and Trm734 reveals a novel binding interface for tRNA recognition.
13	PDB:6elzw	0.684	0.392	1.684E-16	436	0.207	0.117	6elzw.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
14	PDB:7nacw	0.729	0.275	2.040E-16	672	0.248	0.091	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:6ylxw	0.668	0.466	4.683E-14	360	0.220	0.150	6ylxw.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
16	PDB:4by9E	0.432	0.465	5.319E-8	227	0.138	0.150	4by9E.pdb.gz	The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
17	PDB:1ej6A	0.474	0.110	2.632E-7	1284	0.154	0.030	1ej6A.pdb.gz	Structure of the reovirus core at 3.6 A resolution.
18	PDB:6u1xA	0.551	0.074	3.188E-7	2059	0.167	0.020	6u1xA.pdb.gz	Structure of the Vesicular Stomatitis Virus L Protein in Complex with Its Phosphoprotein Cofactor.
19	PDB:5ginE	0.477	0.512	6.869E-7	227	0.154	0.167	5ginE.pdb.gz	Box C/D guide RNAs recognize a maximum of 10 nt of substrates
20	PDB:7mq8SD	0.462	0.478	7.806E-7	237	0.150	0.156	7mq8SD.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UI43	0.0	508	246	1.000	1.000	MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1
2	Q9CPY0	7.18e-144	404	246	0.789	0.789	MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Mrm2 PE=1 SV=1
3	Q9VDT6	4.74e-60	191	250	0.366	0.360	MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG11447 PE=2 SV=1
4	P0C0R7	1.10e-38	135	209	0.305	0.359	RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) OX=83333 GN=rlmE PE=1 SV=1
5	P78860	1.76e-38	135	218	0.305	0.344	MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm2 PE=2 SV=2
6	Q9VDD9	2.30e-35	130	320	0.293	0.225	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
7	P38238	2.58e-31	119	310	0.305	0.242	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
8	Q9UET6	3.67e-31	119	329	0.285	0.213	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
9	P53123	1.44e-28	112	320	0.333	0.256	MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM2 PE=1 SV=1
10	O36015	2.15e-28	110	285	0.272	0.235	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
11	Q9VEP1	3.22e-28	110	302	0.280	0.228	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
12	Q586Q7	1.98e-23	100	905	0.272	0.074	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
13	Q8IY81	2.08e-23	100	847	0.285	0.083	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
14	F4JTD2	1.85e-20	92.0	821	0.252	0.076	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
15	O42832	4.28e-20	91.3	802	0.252	0.077	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
16	P25582	9.25e-16	78.6	841	0.240	0.070	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
17	Q57Y21	3.91e-06	49.3	284	0.248	0.215	Q57Y21_TRYB2 rRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.360 PE=4 SV=1
18	Q8TFH4	3.62e-05	46.2	301	0.240	0.196	YIKA_SCHPO Putative ribosomal RNA methyltransferase PB17E12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB17E12.10c PE=3 SV=1
19	Q9UAS6	0.16	35.4	700	0.102	0.036	CMTR2_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=cmtr2 PE=2 SV=2
20	Q29549	0.20	35.0	446	0.073	0.040	CLUS_PIG Clusterin OS=Sus scrofa OX=9823 GN=CLU PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	2.5e-49	179.3	FtsJ-like methyltransferase
2	PF13489 Methyltransf_23	14	17.0	Methyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481559	0.945	rRNA methyltransferase 1, mitochondrial
2	9606.ENSP00000359859	0.849	Mitochondrial ribosome-associated GTPase 2
3	9606.ENSP00000306080	0.806	rRNA methyltransferase 3, mitochondrial
4	9606.ENSP00000230340	0.800	Bystin
5	9606.ENSP00000365837	0.789	tRNA pseudouridine synthase A
6	9606.ENSP00000323047	0.774	Mitochondrial ribosome-associated GTPase 1
7	9606.ENSP00000419740	0.771	5-methylcytosine rRNA methyltransferase NSUN4
8	9606.ENSP00000274849	0.767	Activator of basal transcription 1
9	9606.ENSP00000203001	0.746	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
10	9606.ENSP00000302801	0.743	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
11	9606.ENSP00000313422	0.725	ADP-ribosylation factor-like protein 6-interacting protein 4
12	9606.ENSP00000366519	0.711	Putative methyltransferase NSUN6
13	9606.ENSP00000385995	0.700	Thyroid adenoma-associated protein
14	9606.ENSP00000354040	0.692	Nucleolar GTP-binding protein 1
15	9606.ENSP00000356134	0.683	Dimethyladenosine transferase 1, mitochondrial
16	9606.ENSP00000360412	0.683	Nucleolar complex protein 3 homolog
17	9606.ENSP00000333934	0.680	tRNA (guanine(10)-N2)-methyltransferase homolog
18	9606.ENSP00000455106	0.680	Ribosome biogenesis protein BOP1
19	9606.ENSP00000298317	0.679	Mitochondrial RNA pseudouridine synthase RPUSD4
20	9606.ENSP00000227474	0.673	tRNA pseudouridine(38/39) synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0062105	1.000	RNA 2'-O-methyltransferase activity
GO:0008649	1.000	rRNA methyltransferase activity
GO:0005488	0.816	binding
GO:0016436	0.806	rRNA (uridine) methyltransferase activity
GO:0008650	0.766	rRNA (uridine-2'-O-)-methyltransferase activity
GO:0005515	0.630	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0042255	0.995	ribosome assembly
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0034641	0.983	cellular nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0090304	0.973	nucleic acid metabolic process
GO:0016070	0.963	RNA metabolic process
GO:0042273	0.951	ribosomal large subunit biogenesis
GO:0010467	0.947	gene expression
GO:0034470	0.937	ncRNA processing
GO:0000027	0.936	ribosomal large subunit assembly
GO:0009451	0.919	RNA modification
GO:0006364	0.899	rRNA processing
GO:0044260	0.849	cellular macromolecule metabolic process
GO:0032259	0.839	methylation
GO:0001510	0.825	RNA methylation
GO:0000154	0.728	rRNA modification
GO:0031167	0.710	rRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031981	0.999	nuclear lumen
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005730	0.953	nucleolus
GO:0005759	0.782	mitochondrial matrix
GO:0005654	0.753	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58956	1.000	a ribonucleotide in RNA + S-adenosyl-L-methionine = a 2'-O-methylribonucleotide in RNA + H(+) + S-adenosyl-L-homocysteine

[back to server]