StarFunc result for job id Q9UI46

User Input

>input (699 residues)
MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDA
ELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRR
QHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTP
KQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEK
QEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQ
DFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQ
SRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQP
SFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKV
EGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHN
MSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAA
VTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSP
NLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286ZPL5	0.689	0.684	0.000	704	0.870	0.864	A0A286ZPL5.pdb.gz	A0A286ZPL5_PIG Dynein axonemal intermediate chain 1 OS=Sus scrofa OX=9823 GN=DNAI1 PE=4 SV=2
2	AFDB:Q5XIL8	0.739	0.733	0.000	705	0.860	0.852	Q5XIL8.pdb.gz	DNAI1_RAT Dynein axonemal intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1
3	AFDB:Q9UI46	1.000	1.000	0.000	699	1.000	1.000	Q9UI46.pdb.gz	DNAI1_HUMAN Dynein axonemal intermediate chain 1 OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1
4	PDB:7kzmD	0.606	0.917	3.862E-49	456	0.313	0.480	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	AFDB:Q586W0	0.580	0.474	4.461E-41	864	0.227	0.184	Q586W0.pdb.gz	Q586W0_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.380 PE=4 SV=1
6	AFDB:Q5XPS1	0.495	0.332	8.437E-41	1057	0.226	0.149	Q5XPS1.pdb.gz	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1
7	AFDB:O94518	0.469	0.592	7.704E-28	544	0.150	0.193	O94518.pdb.gz	DIC1_SCHPO Dynein intermediate chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dic1 PE=1 SV=2
8	PDB:6rlbD	0.451	0.687	2.938E-21	446	0.144	0.226	6rlbD.pdb.gz
9	PDB:3w15A	0.417	0.833	2.982E-19	336	0.080	0.167	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
10	PDB:2ybaB	0.403	0.705	3.496E-19	382	0.087	0.160	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
11	PDB:7kzmE	0.467	0.674	4.100E-19	474	0.123	0.181	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
12	PDB:6f1tp	0.409	0.687	9.094E-19	401	0.123	0.214	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
13	AFDB:Q5BF00	0.387	0.742	1.225E-18	355	0.082	0.161	Q5BF00.pdb.gz	Q5BF00_EMENI Peroxin-7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00880 PE=3 SV=1
14	PDB:3gfcA	0.398	0.780	1.814E-18	339	0.087	0.180	3gfcA.pdb.gz
15	PDB:6zrdA	0.385	0.629	2.580E-17	411	0.083	0.141	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
16	PDB:7vggA	0.384	0.845	2.869E-17	304	0.072	0.164	7vggA.pdb.gz
17	PDB:6rlbC	0.391	0.539	3.190E-17	494	0.107	0.152	6rlbC.pdb.gz
18	AFDB:Q04724	0.379	0.346	8.868E-16	770	0.117	0.106	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
19	AFDB:P97499	0.344	0.097	1.638E-11	2629	0.092	0.024	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
20	AFDB:O96221	0.386	0.193	2.329E-10	1471	0.052	0.024	O96221.pdb.gz	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RCF4	0.0	1309	693	0.934	0.942	A0A0D9RCF4_CHLSB Dynein axonemal intermediate chain 1 OS=Chlorocebus sabaeus OX=60711 GN=DNAI1 PE=4 SV=1
2	A0A286ZPL5	0.0	1234	704	0.866	0.859	A0A286ZPL5_PIG Dynein axonemal intermediate chain 1 OS=Sus scrofa OX=9823 GN=DNAI1 PE=4 SV=2
3	Q5XIL8	0.0	1213	705	0.851	0.844	DNAI1_RAT Dynein axonemal intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1
4	Q8C0M8	0.0	1238	701	0.863	0.860	DNAI1_MOUSE Dynein axonemal intermediate chain 1 OS=Mus musculus OX=10090 GN=Dnai1 PE=1 SV=1
5	Q9UI46	0.0	1466	699	1.000	1.000	DNAI1_HUMAN Dynein axonemal intermediate chain 1 OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1
6	Q39578	4.81e-177	523	683	0.412	0.422	DYI2_CHLRE Dynein, 78 kDa intermediate chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA9 PE=1 SV=3
7	Q8MSJ9	3.69e-175	520	739	0.363	0.344	Q8MSJ9_DROME GH05829p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9313 PE=2 SV=1
8	A0A0B4LG18	4.10e-175	520	740	0.363	0.343	A0A0B4LG18_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9313 PE=4 SV=1
9	Q385R8	2.93e-152	458	655	0.372	0.397	Q385R8_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2640 PE=4 SV=1
10	Q6GPB9	1.03e-68	241	742	0.229	0.216	DNAI4_XENLA Dynein axonemal intermediate chain 4 OS=Xenopus laevis OX=8355 GN=dnai4 PE=2 SV=1
11	E9PYY5	1.93e-67	239	807	0.269	0.233	DNAI4_MOUSE Dynein axonemal intermediate chain 4 OS=Mus musculus OX=10090 GN=Dnai4 PE=1 SV=1
12	F1QHZ6	6.66e-67	237	778	0.236	0.212	DNAI4_DANRE Dynein axonemal intermediate chain 4 OS=Danio rerio OX=7955 GN=dnai4 PE=2 SV=1
13	Q5XPS1	3.66e-54	203	1057	0.156	0.103	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1
14	Q586W0	9.58e-47	180	864	0.166	0.134	Q586W0_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.380 PE=4 SV=1
15	Q8T0V3	3.95e-36	147	684	0.160	0.164	Q8T0V3_DROME Dynein intermediate chain at 61B, isoform B OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=2 SV=1
16	Q9W0U9	4.37e-36	147	764	0.160	0.147	Q9W0U9_DROME Dynein intermediate chain at 61B, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=4 SV=1
17	Q8IGZ6	5.38e-36	147	791	0.160	0.142	Q8IGZ6_DROME LP11180p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=2 SV=1
18	Q9GZS0	1.04e-30	130	605	0.140	0.162	DNAI2_HUMAN Dynein axonemal intermediate chain 2 OS=Homo sapiens OX=9606 GN=DNAI2 PE=1 SV=2
19	E7F6H7	1.47e-25	114	626	0.143	0.160	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
20	A2AC93	1.97e-25	114	623	0.136	0.152	DNAI2_MOUSE Dynein axonemal intermediate chain 2 OS=Mus musculus OX=10090 GN=Dnai2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00400 WD40	6.2e-05	34.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265104	0.965	Dynein heavy chain 5, axonemal
2	9606.ENSP00000354791	0.942	Dynactin subunit 1
3	9606.ENSP00000475939	0.914	Dynein heavy chain 11, axonemal
4	9606.ENSP00000318429	0.911	Coiled-coil domain-containing protein 114
5	9606.ENSP00000199447	0.906	Thioredoxin domain-containing protein 3
6	9606.ENSP00000262442	0.900	Dynein heavy chain 9, axonemal
7	9606.ENSP00000294664	0.894	WD repeat-containing protein 63
8	9606.ENSP00000333363	0.879	Dynein heavy chain 8, axonemal
9	9606.ENSP00000401514	0.876	Dynein heavy chain 1, axonemal
10	9606.ENSP00000380679	0.870	Coiled-coil domain-containing protein 40
11	9606.ENSP00000311273	0.868	Dynein heavy chain 7, axonemal
12	9606.ENSP00000408910	0.850	Dynactin subunit 2
13	9606.ENSP00000484634	0.849	Protein tilB homolog
14	9606.ENSP00000391692	0.844	Coiled-coil domain containing 103
15	9606.ENSP00000391869	0.839	annotation not available
16	9606.ENSP00000452037	0.839	Dynein light chain 1, axonemal
17	9606.ENSP00000298292	0.837	Protein kintoun
18	9606.ENSP00000261383	0.832	Dynein heavy chain 3, axonemal
19	9606.ENSP00000288710	0.829	Dynein regulatory complex protein 1
20	9606.ENSP00000259632	0.826	Dynactin subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.430	cytoskeletal motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007017	0.995	microtubule-based process
GO:0009799	0.995	specification of symmetry
GO:0060972	0.995	left/right pattern formation
GO:0003341	0.993	cilium movement
GO:0007368	0.990	determination of left/right symmetry
GO:0071840	0.896	cellular component organization or biogenesis
GO:0016043	0.858	cellular component organization
GO:0006996	0.854	organelle organization
GO:0060271	0.816	cilium assembly
GO:0035082	0.778	axoneme assembly
GO:0070286	0.579	axonemal dynein complex assembly
GO:0060285	0.524	cilium-dependent cell motility
GO:0050789	0.406	regulation of biological process
GO:0050794	0.404	regulation of cellular process
GO:0060294	0.355	cilium movement involved in cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005856	0.999	cytoskeleton
GO:0042995	0.995	cell projection
GO:0005929	0.993	cilium
GO:0032991	0.989	protein-containing complex
GO:0015630	0.989	microtubule cytoskeleton
GO:0005930	0.928	axoneme
GO:0005875	0.897	microtubule associated complex
GO:1902494	0.741	catalytic complex
GO:0031514	0.612	motile cilium
GO:0005858	0.499	axonemal dynein complex
GO:0005815	0.413	microtubule organizing center
GO:0043231	0.310	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]