StarFunc result for job id Q9UI95

User Input

>input (211 residues)
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AK44	0.966	0.910	1.028E-39	224	0.991	0.933	B1AK44.pdb.gz	B1AK44_HUMAN Mitotic arrest deficient 2 like 2 OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=1
2	PDB:6keaD	0.923	0.337	4.466E-34	584	0.934	0.337	6keaD.pdb.gz
3	PDB:3abdA	0.836	0.979	9.792E-32	180	0.839	0.983	3abdA.pdb.gz	Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase {zeta} and REV1
4	AFDB:B1AK43	0.716	0.766	2.675E-24	197	0.735	0.787	B1AK43.pdb.gz	B1AK43_HUMAN Mitotic arrest deficient 2 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=8
5	PDB:6bi7G	0.712	0.971	3.411E-23	154	0.716	0.981	6bi7G.pdb.gz	Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
6	AFDB:Q94FL5	0.850	0.835	1.214E-19	215	0.308	0.302	Q94FL5.pdb.gz	REV7_ARATH DNA polymerase zeta processivity subunit OS=Arabidopsis thaliana OX=3702 GN=REV7 PE=2 SV=1
7	AFDB:Q556Y9	0.773	0.801	4.683E-16	203	0.223	0.232	Q556Y9.pdb.gz	MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum OX=44689 GN=mad2l1-1 PE=3 SV=1
8	AFDB:O14417	0.824	0.854	5.562E-16	203	0.223	0.232	O14417.pdb.gz	MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad2 PE=1 SV=1
9	AFDB:Q13257	0.764	0.785	9.870E-16	205	0.213	0.220	Q13257.pdb.gz	MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens OX=9606 GN=MAD2L1 PE=1 SV=1
10	AFDB:Q57ZD6	0.787	0.824	1.315E-15	201	0.237	0.249	Q57ZD6.pdb.gz	Q57ZD6_TRYB2 Rev7, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.370 PE=4 SV=1
11	AFDB:Q59VQ3	0.780	0.770	2.934E-15	214	0.194	0.192	Q59VQ3.pdb.gz	MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAD2 PE=3 SV=1
12	AFDB:Q9VNE1	0.789	0.837	3.107E-15	198	0.256	0.273	Q9VNE1.pdb.gz	POLZ2_DROME DNA polymerase zeta subunit 2 OS=Drosophila melanogaster OX=7227 GN=PolZ2 PE=1 SV=1
13	AFDB:Q9VRQ2	0.792	0.807	3.691E-15	207	0.194	0.198	Q9VRQ2.pdb.gz	Q9VRQ2_DROME Mad2 OS=Drosophila melanogaster OX=7227 GN=mad2 PE=1 SV=1
14	PDB:2v64A	0.746	0.749	1.411E-14	210	0.213	0.214	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
15	PDB:4aezH	0.767	0.867	1.495E-14	185	0.204	0.232	4aezH.pdb.gz
16	PDB:4trkA	0.668	0.590	3.192E-9	242	0.166	0.145	4trkA.pdb.gz
17	PDB:7lxdE	0.631	0.647	1.253E-7	205	0.199	0.205	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
18	PDB:7lxdD	0.580	0.728	1.964E-6	163	0.175	0.227	7lxdD.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
19	PDB:4yk8A	0.499	0.629	6.755E-3	162	0.085	0.111	4yk8A.pdb.gz
20	PDB:6sgaFS	0.142	0.120	1.059E-1	277	0.095	0.072	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UI95	2.91e-156	432	211	1.000	1.000	MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=2
2	D3Z8D9	1.02e-153	426	211	0.986	0.986	MD2L2_RAT Mitotic spindle assembly checkpoint protein MAD2B OS=Rattus norvegicus OX=10116 GN=Mad2l2 PE=2 SV=1
3	B1AK44	3.48e-152	422	224	1.000	0.942	B1AK44_HUMAN Mitotic arrest deficient 2 like 2 OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=1
4	Q4KWZ6	1.21e-151	421	211	0.967	0.967	MD2L2_CHICK Mitotic spindle assembly checkpoint protein MAD2B OS=Gallus gallus OX=9031 GN=MAD2L2 PE=1 SV=1
5	Q8QFR4	7.92e-138	386	211	0.934	0.934	MD2L2_XENLA Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus laevis OX=8355 GN=mad2l2 PE=1 SV=1
6	B1AK45	2.74e-120	340	167	0.791	1.000	B1AK45_HUMAN Mitotic spindle assembly checkpoint protein MAD2B (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=1
7	B1AK43	6.23e-114	325	197	0.791	0.848	B1AK43_HUMAN Mitotic arrest deficient 2 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=8
8	Q94FL5	2.58e-30	113	215	0.318	0.312	REV7_ARATH DNA polymerase zeta processivity subunit OS=Arabidopsis thaliana OX=3702 GN=REV7 PE=2 SV=1
9	Q9VNE1	2.26e-19	84.0	198	0.270	0.288	POLZ2_DROME DNA polymerase zeta subunit 2 OS=Drosophila melanogaster OX=7227 GN=PolZ2 PE=1 SV=1
10	Q0E7J8	1.89e-14	71.2	213	0.218	0.216	REV7_SCHPO DNA polymerase zeta processivity subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rev7 PE=3 SV=1
11	Q57ZD6	2.67e-14	70.5	201	0.227	0.239	Q57ZD6_TRYB2 Rev7, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.370 PE=4 SV=1
12	Q556Y9	2.58e-10	59.7	203	0.185	0.192	MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum OX=44689 GN=mad2l1-1 PE=3 SV=1
13	Q9Z1B5	4.41e-10	59.3	205	0.180	0.185	MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus OX=10090 GN=Mad2l1 PE=1 SV=2
14	P40958	5.44e-10	58.9	196	0.246	0.265	MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD2 PE=1 SV=1
15	Q9VRQ2	7.61e-10	58.5	207	0.175	0.179	Q9VRQ2_DROME Mad2 OS=Drosophila melanogaster OX=7227 GN=mad2 PE=1 SV=1
16	Q13257	1.61e-08	54.7	205	0.180	0.185	MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens OX=9606 GN=MAD2L1 PE=1 SV=1
17	Q5BAB9	1.20e-07	52.8	225	0.223	0.209	Q5BAB9_EMENI Mitotic spindle checkpoint protein (Mad2), putative (AFU_orthologue AFUA_3G14340) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02511 PE=3 SV=1
18	O14417	1.45e-07	52.0	203	0.171	0.177	MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad2 PE=1 SV=1
19	Q59VQ3	1.48e-06	49.3	214	0.114	0.112	MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAD2 PE=3 SV=1
20	Q9LU93	2.65e-06	48.5	209	0.218	0.220	MAD2_ARATH Mitotic spindle checkpoint protein MAD2 OS=Arabidopsis thaliana OX=3702 GN=MAD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02301 HORMA	7.2e-06	37.3	HORMA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010351806.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369952.1	0.999	REV3 like, DNA directed polymerase zeta catalytic subunit
2	61622.XP_010385069.1	0.996	Deoxycytidyl transferase involved in DNA repair. Transfers a dCMP residue from dCTP to the 3'-end of a DNA primer in a template- dependent reaction. May assist in the first step in the bypass of abasic lesions by the insertion of a nucleotide opposite the lesion. Required for normal induction of mutations by physical and chemical agents
3	61622.XP_010367848.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 149 ESTs, 2 Proteins, and 81% coverage of the annotated genomic feature by RNAseq alignments
4	61622.XP_010372857.1	0.983	DNA polymerase delta subunit 2 isoform X1
5	61622.XP_010365122.1	0.972	DNA polymerase delta 3, accessory subunit
6	61622.XP_010351529.1	0.971	DNA polymerase alpha 1, catalytic subunit
7	61622.XP_010376878.1	0.967	DNA polymerase epsilon catalytic subunit A
8	61622.XP_010365593.1	0.945	Fizzy/cell division cycle 20 related 1
9	61622.XP_010362232.1	0.936	DNA polymerase alpha subunit B
10	61622.XP_010387796.1	0.929	DNA polymerase epsilon subunit 2 isoform X1
11	61622.XP_010373121.1	0.928	Chromosome alignment-maintaining phosphoprotein 1
12	61622.XP_010363172.1	0.920	MAD2 mitotic arrest deficient-like 1 (yeast)
13	61622.XP_010377574.1	0.910	DNA polymerase epsilon 4, accessory subunit
14	61622.XP_010357896.1	0.904	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 31% coverage of the annotated genomic feature by RNAseq alignments
15	61622.XP_010372412.1	0.904	Family with sequence similarity 35 member A
16	61622.XP_010368038.1	0.901	DNA polymerase eta isoform X1
17	61622.XP_010378304.1	0.900	DNA polymerase subunit gamma-2, mitochondrial
18	61622.XP_010366008.1	0.898	Uncharacterized protein LOC104665792
19	61622.XP_010368780.1	0.894	DNA polymerase epsilon subunit 3
20	61622.XP_010351132.1	0.884	DNA polymerase kappa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.995	identical protein binding
GO:0019899	0.993	enzyme binding
GO:0008134	0.969	transcription factor binding
GO:0061629	0.819	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019901	0.816	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0050896	0.990	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0006725	0.986	cellular aromatic compound metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0051716	0.981	cellular response to stimulus
GO:0044260	0.978	cellular macromolecule metabolic process
GO:0006139	0.975	nucleobase-containing compound metabolic process
GO:0090304	0.968	nucleic acid metabolic process
GO:0006950	0.965	response to stress
GO:0051128	0.959	regulation of cellular component organization
GO:0019222	0.957	regulation of metabolic process
GO:0006302	0.957	double-strand break repair
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0048518	0.927	positive regulation of biological process
GO:0048522	0.908	positive regulation of cellular process
GO:0009893	0.889	positive regulation of metabolic process
GO:0080090	0.873	regulation of primary metabolic process
GO:0010604	0.872	positive regulation of macromolecule metabolic process
GO:0007346	0.871	regulation of mitotic cell cycle
GO:0051171	0.870	regulation of nitrogen compound metabolic process
GO:0048519	0.866	negative regulation of biological process
GO:0051246	0.863	regulation of protein metabolic process
GO:0010564	0.858	regulation of cell cycle process
GO:0031399	0.838	regulation of protein modification process
GO:1901987	0.826	regulation of cell cycle phase transition
GO:0065009	0.821	regulation of molecular function
GO:0010948	0.778	negative regulation of cell cycle process
GO:1903320	0.777	regulation of protein modification by small protein conjugation or removal
GO:0010639	0.760	negative regulation of organelle organization
GO:0050793	0.740	regulation of developmental process
GO:0031396	0.738	regulation of protein ubiquitination
GO:0033044	0.730	regulation of chromosome organization
GO:0048583	0.727	regulation of response to stimulus
GO:0031323	0.725	regulation of cellular metabolic process
GO:0051338	0.710	regulation of transferase activity
GO:0010468	0.699	regulation of gene expression
GO:0051239	0.691	regulation of multicellular organismal process
GO:0019219	0.686	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.683	regulation of DNA metabolic process
GO:0051172	0.671	negative regulation of nitrogen compound metabolic process
GO:0051173	0.668	positive regulation of nitrogen compound metabolic process
GO:1901990	0.666	regulation of mitotic cell cycle phase transition
GO:0031325	0.652	positive regulation of cellular metabolic process
GO:0010605	0.650	negative regulation of macromolecule metabolic process
GO:0051983	0.626	regulation of chromosome segregation
GO:0010717	0.625	regulation of epithelial to mesenchymal transition
GO:0031400	0.618	negative regulation of protein modification process
GO:0045935	0.603	positive regulation of nucleobase-containing compound metabolic process
GO:0031397	0.580	negative regulation of protein ubiquitination
GO:0071840	0.565	cellular component organization or biogenesis
GO:0016043	0.518	cellular component organization
GO:0009894	0.510	regulation of catabolic process
GO:0033045	0.509	regulation of sister chromatid segregation
GO:0009895	0.478	negative regulation of catabolic process
GO:0010965	0.478	regulation of mitotic sister chromatid separation
GO:0040008	0.475	regulation of growth
GO:0010628	0.473	positive regulation of gene expression
GO:0051240	0.465	positive regulation of multicellular organismal process
GO:0044092	0.457	negative regulation of molecular function
GO:0007154	0.452	cell communication
GO:0051094	0.451	positive regulation of developmental process
GO:0007165	0.440	signal transduction
GO:0051783	0.412	regulation of nuclear division
GO:0030071	0.404	regulation of mitotic metaphase/anaphase transition
GO:1903053	0.401	regulation of extracellular matrix organization
GO:0007049	0.398	cell cycle
GO:0022402	0.394	cell cycle process
GO:1905819	0.393	negative regulation of chromosome separation
GO:1901988	0.389	negative regulation of cell cycle phase transition
GO:0000075	0.369	cell cycle checkpoint signaling
GO:1903047	0.359	mitotic cell cycle process
GO:0042176	0.342	regulation of protein catabolic process
GO:0006996	0.338	organelle organization
GO:0048584	0.337	positive regulation of response to stimulus
GO:0007093	0.327	mitotic cell cycle checkpoint signaling
GO:1901991	0.310	negative regulation of mitotic cell cycle phase transition
GO:0006310	0.306	DNA recombination
GO:0051054	0.303	positive regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005829	0.993	cytosol
GO:0005654	0.992	nucleoplasm
GO:0032991	0.959	protein-containing complex
GO:0005730	0.885	nucleolus
GO:0140513	0.880	nuclear protein-containing complex
GO:1902494	0.862	catalytic complex
GO:1990234	0.852	transferase complex
GO:0140535	0.851	intracellular protein-containing complex
GO:0005694	0.845	chromosome
GO:0031461	0.315	cullin-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]