StarFunc result for job id Q9UIA9

User Input

>input (1087 residues)
MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQ
LLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGW
FDCQKDDYVFRNAITDVTRFLQDSVEYCIIGVTILSQLTNEINQADTTHPLTKHRKIASS
FRDSSLFDIFTLSCNLLKQASGKNLNLNDESQHGLLMQLLKLTHNCLNFDFIGTSTDESS
DDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAER
AKFLSHLVDGVKRILENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIA
NFTVTSLQHWEFAPNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLES
VHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSAS
ASPMDIAVQEGRLTWLVYIIGAVIGGRVSFASTDEQDAMDGELVCRVLQLMNLTDSRLAQ
AGNEKLELAMLSFFEQFRKIYIGDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNL
KYWGRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFLGINNQSNLT
DMRCRTTFYTALGRLLMVDLGEDEDQYEQFMLPLTAAFEAVAQMFSTNSFNEQEAKRTLV
GLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPACTTPVLKLMAELVH
NRSQRLQFDVSSPNGILLFRETSKMITMYGNRILTLGEVPKDQVYALKLKGISICFSMLK
AALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQD
HMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSTKKRTTP
LNQESDRFLHIMQQHPEMIQQMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLR
NSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMKNSTYGV
NSNDMMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EPK7	0.994	0.994	0.000	1087	0.994	0.994	Q9EPK7.pdb.gz	XPO7_MOUSE Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 SV=3
2	AFDB:Q99NF8	0.971	0.970	3.658E-91	1088	0.665	0.665	Q99NF8.pdb.gz	RBP17_MOUSE Ran-binding protein 17 OS=Mus musculus OX=10090 GN=Ranbp17 PE=1 SV=1
3	AFDB:Q38FR1	0.761	0.760	1.532E-26	1088	0.186	0.186	Q38FR1.pdb.gz	Q38FR1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1250 PE=3 SV=1
4	AFDB:Q9C0E2	0.725	0.689	1.008E-25	1151	0.186	0.175	Q9C0E2.pdb.gz	XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2
5	AFDB:Q388L1	0.603	0.604	2.498E-15	1086	0.148	0.148	Q388L1.pdb.gz	Q388L1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3040 PE=3 SV=1
6	AFDB:Q924Z6	0.599	0.582	8.472E-14	1125	0.144	0.140	Q924Z6.pdb.gz	XPO6_MOUSE Exportin-6 OS=Mus musculus OX=10090 GN=Xpo6 PE=1 SV=2
7	AFDB:F1Q9F5	0.583	0.649	1.825E-13	953	0.128	0.146	F1Q9F5.pdb.gz	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
8	PDB:6gx9A	0.590	0.685	2.801E-13	912	0.121	0.144	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
9	AFDB:F4IZR5	0.597	0.602	2.975E-13	1076	0.155	0.157	F4IZR5.pdb.gz	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
10	AFDB:P30822	0.623	0.624	4.521E-13	1084	0.143	0.143	P30822.pdb.gz	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
11	PDB:2xwuB	0.449	0.508	4.566E-13	910	0.121	0.145	2xwuB.pdb.gz
12	AFDB:Q9SMV6	0.602	0.608	5.383E-13	1075	0.146	0.148	Q9SMV6.pdb.gz	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
13	PDB:5uwuC	0.605	0.650	1.055E-12	998	0.148	0.161	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
14	PDB:4c0qA	0.568	0.680	3.454E-12	871	0.117	0.146	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
15	PDB:3wyfC	0.624	0.648	9.500E-12	1040	0.148	0.155	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
16	PDB:3gjxA	0.590	0.612	2.802E-10	1041	0.143	0.149	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
17	PDB:2x1gF	0.514	0.601	1.843E-9	896	0.111	0.135	2x1gF.pdb.gz
18	PDB:3icqT	0.505	0.555	2.195E-9	949	0.136	0.156	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
19	PDB:3gb8A	0.565	0.630	2.273E-9	958	0.134	0.152	3gb8A.pdb.gz
20	PDB:5yu7A	0.443	0.433	4.259E-9	1118	0.134	0.131	5yu7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99NF8	0.0	1562	1088	0.666	0.665	RBP17_MOUSE Ran-binding protein 17 OS=Mus musculus OX=10090 GN=Ranbp17 PE=1 SV=1
2	Q9EPK7	0.0	2239	1087	0.994	0.994	XPO7_MOUSE Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 SV=3
3	Q9UIA9	0.0	2252	1087	1.000	1.000	XPO7_HUMAN Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3
4	Q38FR1	8.31e-18	91.7	1088	0.102	0.102	Q38FR1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1250 PE=3 SV=1
5	Q9C0E2	1.39e-13	78.2	1151	0.072	0.068	XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2
6	Q0VG75	3.82e-12	73.2	1124	0.065	0.063	Q0VG75_HUMAN Exportin 4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=1
7	P30822	1.24e-04	48.9	1084	0.023	0.023	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
8	F4IZR5	0.011	42.4	1076	0.069	0.070	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
9	P14068	0.015	42.0	1078	0.018	0.019	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
10	Q9USZ2	0.036	40.8	955	0.033	0.038	YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2
11	C8VRM0	0.19	38.5	1072	0.021	0.021	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
12	Q381F2	0.22	38.1	1149	0.038	0.036	Q381F2_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8030 PE=4 SV=1
13	Q388L1	0.38	37.4	1086	0.029	0.029	Q388L1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3040 PE=3 SV=1
14	Q9SMV6	0.52	37.0	1075	0.067	0.068	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
15	Q09590	0.80	36.2	662	0.037	0.060	Q09590_CAEEL NADPH--cytochrome P450 reductase OS=Caenorhabditis elegans OX=6239 GN=emb-8 PE=1 SV=1
16	A0A1D8PRR9	0.86	36.2	1079	0.017	0.017	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
17	Q8T8P1	3.9	33.9	763	0.030	0.043	Q8T8P1_TRYBB DNA repair protein Mre11 OS=Trypanosoma brucei brucei OX=5702 GN=MRE11 PE=4 SV=1
18	Q8WPP1	4.0	33.9	763	0.030	0.043	Q8WPP1_9TRYP Mre11 protein OS=Trypanosoma brucei OX=5691 GN=Mre11 PE=4 SV=1
19	Q9HDV6	4.1	33.9	2196	0.032	0.016	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
20	Q586P4	4.2	33.9	763	0.030	0.043	Q586P4_TRYB2 Endo/exonuclease Mre11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.385 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03810 IBN_N	1e-09	49.5	Importin-beta N-terminal domain
2	PF08389 Xpo1	30	16.1	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007450614.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007472456.1	0.908	3'-phosphoadenosine 5'-phosphosulfate synthase 1
2	118797.XP_007456808.1	0.787	Tousled like kinase 2
3	118797.XP_007470550.1	0.760	DSCR3 arrestin fold containing
4	118797.XP_007464198.1	0.731	Exportin 1
5	118797.XP_007451005.1	0.723	GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle.
6	118797.XP_007455513.1	0.723	RAN, member RAS oncogene family
7	118797.XP_007457821.1	0.716	Eukaryotic translation initiation factor 5A
8	118797.XP_007452881.1	0.695	Exportin-6
9	118797.XP_007450617.1	0.670	Dematin actin binding protein
10	118797.XP_007450613.1	0.668	Docking protein 2
11	118797.XP_007453285.1	0.663	DEP domain containing 1B
12	118797.XP_007450625.1	0.629	Leucine-rich repeat LGI family member 3
13	118797.XP_007458380.1	0.628	Exportin-5
14	118797.XP_007448552.1	0.626	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
15	118797.XP_007464788.1	0.620	Eukaryotic translation initiation factor 5A2
16	118797.XP_007450644.1	0.593	Sorbin and SH3 domain containing 3
17	118797.XP_007468320.1	0.590	Importin 13
18	118797.XP_007458876.1	0.589	Belongs to the GDA1/CD39 NTPase family.
19	118797.XP_007448675.1	0.587	Ubiquitin carboxyl-terminal hydrolase 14 isoform X1
20	118797.XP_007450646.1	0.582	PDZ and LIM domain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005049	0.996	nuclear export signal receptor activity
GO:0097159	0.335	organic cyclic compound binding
GO:1901363	0.317	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.987	localization
GO:0046907	0.966	intracellular transport
GO:0006913	0.927	nucleocytoplasmic transport
GO:0033036	0.551	macromolecule localization
GO:0008104	0.528	protein localization
GO:0071702	0.418	organic substance transport
GO:0071705	0.415	nitrogen compound transport
GO:0006886	0.388	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005643	0.996	nuclear pore
GO:0005829	0.919	cytosol
GO:0016020	0.691	membrane
GO:0031974	0.521	membrane-enclosed lumen
GO:0070013	0.487	intracellular organelle lumen
GO:0031981	0.365	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]