StarFunc result for job id Q9UIB8

User Input

>input (345 residues)
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTT
TKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIB8	1.000	1.000	2.001E-57	345	1.000	1.000	Q9UIB8.pdb.gz	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
2	AFDB:Q5VYH9	0.512	0.322	2.398E-21	565	0.316	0.193	Q5VYH9.pdb.gz	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
3	AFDB:Q8BHK6	0.573	0.592	3.485E-21	333	0.275	0.285	Q8BHK6.pdb.gz	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
4	AFDB:Q01965	0.487	0.280	5.944E-21	654	0.238	0.125	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
5	AFDB:Q9D780	0.537	0.640	1.397E-20	285	0.261	0.316	Q9D780.pdb.gz	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
6	AFDB:Q9HBG7	0.476	0.264	4.063E-20	655	0.264	0.139	Q9HBG7.pdb.gz	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
7	AFDB:Q96A28	0.468	0.551	5.558E-19	289	0.243	0.291	Q96A28.pdb.gz	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
8	AFDB:Q9ET39	0.585	0.576	2.112E-18	351	0.209	0.205	Q9ET39.pdb.gz	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
9	AFDB:A4JYL8	0.474	0.354	3.237E-18	475	0.180	0.131	A4JYL8.pdb.gz
10	AFDB:Q9QUM4	0.488	0.491	1.368E-17	343	0.203	0.204	Q9QUM4.pdb.gz	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
11	PDB:6dldD	0.342	0.423	4.074E-9	269	0.125	0.160	6dldD.pdb.gz
12	PDB:6dlfA	0.326	0.446	1.319E-8	236	0.125	0.182	6dlfA.pdb.gz
13	PDB:4r2gP	0.231	0.362	1.816E-8	210	0.081	0.133	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
14	PDB:1a8jL	0.219	0.328	1.058E-7	216	0.090	0.144	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
15	PDB:6vpyL	0.205	0.294	1.177E-7	209	0.087	0.144	6vpyL.pdb.gz
16	PDB:3c2aL	0.215	0.326	1.457E-7	216	0.090	0.144	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
17	PDB:2jb5L	0.223	0.343	1.710E-7	211	0.090	0.147	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
18	PDB:5c7kF	0.208	0.304	2.233E-7	212	0.087	0.142	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
19	PDB:1seqL	0.217	0.336	2.356E-7	208	0.107	0.178	1seqL.pdb.gz
20	PDB:6dcvA	0.201	0.295	2.485E-7	220	0.081	0.127	6dcvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UIB8	0.0	722	345	1.000	1.000	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
2	Q18PI6	5.19e-131	379	329	0.565	0.593	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
3	Q5VYH9	1.18e-35	138	565	0.267	0.163	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
4	Q9HBG7	4.03e-35	137	655	0.267	0.140	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
5	Q96A28	5.28e-34	128	289	0.197	0.235	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
6	Q9D780	9.29e-33	125	285	0.212	0.256	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
7	Q96DU3	3.04e-30	119	332	0.206	0.214	SLAF6_HUMAN SLAM family member 6 OS=Homo sapiens OX=9606 GN=SLAMF6 PE=1 SV=3
8	Q8BHK6	2.36e-28	114	333	0.293	0.303	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
9	Q9NQ25	4.20e-27	111	335	0.304	0.313	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
10	Q01965	5.79e-24	105	654	0.203	0.107	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
11	Q9ET39	1.83e-20	93.2	351	0.203	0.199	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
12	B4DW98	1.86e-13	71.2	241	0.209	0.299	B4DW98_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
13	Q14CZ8	3.64e-10	63.2	416	0.194	0.161	HECAM_HUMAN Hepatic and glial cell adhesion molecule OS=Homo sapiens OX=9606 GN=HEPACAM PE=1 SV=1
14	P10252	3.79e-10	61.6	240	0.165	0.237	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
15	Q13291	9.38e-10	61.6	335	0.148	0.152	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
16	Q640R3	1.47e-09	61.2	418	0.183	0.151	HECAM_MOUSE Hepatic and glial cell adhesion molecule OS=Mus musculus OX=10090 GN=Hepacam PE=1 SV=2
17	Q9BZW8	4.87e-09	59.3	370	0.200	0.186	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
18	P18181	6.55e-09	58.2	240	0.148	0.212	CD48_MOUSE CD48 antigen OS=Mus musculus OX=10090 GN=Cd48 PE=1 SV=1
19	Q9QUM4	3.19e-08	57.0	343	0.171	0.172	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
20	Q9P0V8	6.88e-07	52.4	285	0.159	0.193	SLAF8_HUMAN SLAM family member 8 OS=Homo sapiens OX=9606 GN=SLAMF8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.04	25.3	Immunoglobulin I-set domain
2	PF00047 ig	1.1e-05	36.9	Immunoglobulin domain
3	PF13895 Ig_2	3.2	19.4	Immunoglobulin domain
4	PF13927 Ig_3	4e-07	41.8	Immunoglobulin domain
5	PF16706 Izumo-Ig	4.6e+02	12.1	Izumo-like Immunoglobulin domain
6	PF07686 V-set	8.4	18.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312367

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356906	0.974	SH2 domain-containing protein 1B
2	9606.ENSP00000360181	0.968	SH2 domain-containing protein 1A
3	9606.ENSP00000484431	0.761	CD48 antigen
4	9606.ENSP00000340944	0.707	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000011653	0.576	T-cell surface glycoprotein CD4
6	9606.ENSP00000358490	0.565	T-cell surface antigen CD2
7	9606.ENSP00000411355	0.546	Receptor-type tyrosine-protein phosphatase C
8	9606.ENSP00000292174	0.527	C-X-C chemokine receptor type 5
9	9606.ENSP00000358501	0.526	Lymphocyte function-associated antigen 3
10	9606.ENSP00000346671	0.518	Tyrosine-protein kinase Fyn
11	9606.ENSP00000289902	0.511	High affinity immunoglobulin epsilon receptor subunit gamma
12	9606.ENSP00000285670	0.509	SAM domain-containing protein SAMSN-1
13	9606.ENSP00000274629	0.505	Calcium-activated potassium channel subunit beta-1
14	9606.ENSP00000344465	0.503	Platelet endothelial aggregation receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0001817	0.987	regulation of cytokine production
GO:0048518	0.986	positive regulation of biological process
GO:0048583	0.980	regulation of response to stimulus
GO:0002682	0.970	regulation of immune system process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0002684	0.944	positive regulation of immune system process
GO:0002694	0.944	regulation of leukocyte activation
GO:0050776	0.923	regulation of immune response
GO:0001819	0.887	positive regulation of cytokine production
GO:0048523	0.886	negative regulation of cellular process
GO:0002376	0.873	immune system process
GO:0032879	0.855	regulation of localization
GO:0002697	0.847	regulation of immune effector process
GO:0051241	0.811	negative regulation of multicellular organismal process
GO:0080090	0.771	regulation of primary metabolic process
GO:0051049	0.771	regulation of transport
GO:0002703	0.761	regulation of leukocyte mediated immunity
GO:0048522	0.760	positive regulation of cellular process
GO:0010605	0.748	negative regulation of macromolecule metabolic process
GO:0002699	0.722	positive regulation of immune effector process
GO:0032501	0.677	multicellular organismal process
GO:0002683	0.631	negative regulation of immune system process
GO:0060627	0.623	regulation of vesicle-mediated transport
GO:0017157	0.614	regulation of exocytosis
GO:0010629	0.592	negative regulation of gene expression
GO:0006950	0.565	response to stress
GO:0002886	0.515	regulation of myeloid leukocyte mediated immunity
GO:0048584	0.481	positive regulation of response to stimulus
GO:1903305	0.465	regulation of regulated secretory pathway
GO:0051716	0.416	cellular response to stimulus
GO:0001818	0.412	negative regulation of cytokine production
GO:0006955	0.407	immune response
GO:0006952	0.379	defense response
GO:0051246	0.358	regulation of protein metabolic process
GO:0007154	0.355	cell communication
GO:0007155	0.353	cell adhesion
GO:0007165	0.343	signal transduction
GO:0045321	0.338	leukocyte activation
GO:0031323	0.335	regulation of cellular metabolic process
GO:0002698	0.324	negative regulation of immune effector process
GO:0023051	0.317	regulation of signaling
GO:0010646	0.317	regulation of cell communication
GO:0045920	0.306	negative regulation of exocytosis
GO:0051249	0.303	regulation of lymphocyte activation
GO:0043300	0.303	regulation of leukocyte degranulation
GO:0050866	0.300	negative regulation of cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.707	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]