StarFunc result for job id Q9UIE0

User Input

>input (474 residues)
MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGHQPFHPFHFLRE
EKFWMMETATQREGNSGGKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQG
DVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYI
SALRIHQRVHLREKLSKCDMRGKEFSQSSCLQTRERVHTGEKPFKCEQCGKGFRCRAILQ
VHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM
VHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSYLLIHQRIHSG
EKPYRCEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPF
KCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIE0	1.000	1.000	4.012E-80	474	1.000	1.000	Q9UIE0.pdb.gz	ZN230_HUMAN Zinc finger protein 230 OS=Homo sapiens OX=9606 GN=ZNF230 PE=1 SV=3
2	AFDB:Q12901	0.211	0.190	7.188E-60	538	0.802	0.706	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
3	AFDB:Q9UK11	0.360	0.355	3.623E-56	482	0.795	0.782	Q9UK11.pdb.gz	ZN223_HUMAN Zinc finger protein 223 OS=Homo sapiens OX=9606 GN=ZNF223 PE=1 SV=2
4	AFDB:A8K8Y5	0.225	0.158	1.956E-51	707	0.694	0.465	A8K8Y5.pdb.gz	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:Q9UK10	0.182	0.129	1.411E-50	706	0.732	0.492	Q9UK10.pdb.gz	ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens OX=9606 GN=ZNF225 PE=1 SV=2
6	AFDB:Q9UK13	0.227	0.181	6.125E-50	617	0.705	0.541	Q9UK13.pdb.gz	ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens OX=9606 GN=ZNF221 PE=1 SV=4
7	AFDB:Q02386	0.371	0.266	7.904E-43	682	0.515	0.358	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
8	AFDB:Q96N58	0.440	0.359	6.413E-37	590	0.392	0.315	Q96N58.pdb.gz	ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2
9	AFDB:Q9P2J8	0.404	0.238	9.522E-37	865	0.403	0.221	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
10	AFDB:Q7L2R6	0.382	0.348	1.066E-36	523	0.392	0.356	Q7L2R6.pdb.gz	ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens OX=9606 GN=ZNF765 PE=1 SV=2
11	PDB:3w5kB	0.102	0.298	1.362E-3	110	0.068	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.046	0.196	3.445E-1	62	0.032	0.242	6ydhA.pdb.gz
13	PDB:4kfzB	0.063	0.162	5.411E-1	148	0.065	0.209	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:6gejS	0.060	0.111	1.983	208	0.072	0.163	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:6zheC	0.067	0.050	2.349	705	0.084	0.057	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
16	PDB:5gm6a	0.042	0.119	2.485	123	0.044	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6ff4t	0.058	0.100	2.485	172	0.053	0.145	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7uhyC	0.062	0.053	2.485	578	0.068	0.055	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7pmkQ	0.050	0.040	3.296	766	0.055	0.034	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:4zzlA	0.092	0.201	3.487	146	0.044	0.144	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K8Y5	0.0	627	707	0.696	0.467	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q12901	0.0	745	538	0.800	0.704	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
3	Q9NZL3	0.0	626	707	0.698	0.468	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3
4	Q9UIE0	0.0	979	474	1.000	1.000	ZN230_HUMAN Zinc finger protein 230 OS=Homo sapiens OX=9606 GN=ZNF230 PE=1 SV=3
5	Q9UK10	0.0	602	706	0.675	0.453	ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens OX=9606 GN=ZNF225 PE=1 SV=2
6	Q9UK11	0.0	756	482	0.795	0.782	ZN223_HUMAN Zinc finger protein 223 OS=Homo sapiens OX=9606 GN=ZNF223 PE=1 SV=2
7	Q9UK13	0.0	630	617	0.703	0.540	ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens OX=9606 GN=ZNF221 PE=1 SV=4
8	Q02386	9.49e-148	439	682	0.519	0.361	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
9	Q86WZ6	1.47e-120	373	799	0.485	0.288	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
10	Q8IYB9	4.86e-116	357	648	0.430	0.315	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	Q2NKJ9	3.02e-115	352	569	0.435	0.362	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
12	Q9H8G1	1.61e-114	350	570	0.439	0.365	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
13	Q8IYN0	2.28e-112	343	542	0.430	0.376	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
14	E9QAG8	1.42e-111	341	526	0.401	0.361	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
15	Q8N9F8	1.74e-111	341	522	0.426	0.387	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
16	Q99K53	3.53e-111	345	700	0.458	0.310	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
17	Q8TAQ5	1.11e-110	344	688	0.416	0.286	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	Q6PF04	3.82e-110	340	617	0.418	0.321	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
19	A6NNF4	7.80e-110	340	616	0.426	0.328	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
20	Q9R164	2.22e-109	341	701	0.454	0.307	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	2.9e+02	13.2	BolA-like protein
2	PF01352 KRAB	4.1e-19	79.2	KRAB box
3	PF00253 Ribosomal_S14	50	15.1	Ribosomal protein S14p/S29e
4	PF01428 zf-AN1	11	17.5	AN1-like Zinc finger
5	PF00096 zf-C2H2	4.7e-27	104.0	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	2.1e+02	13.1	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	8.1e-15	65.2	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	35	15.8	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	4.5	18.9	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	9.8e-51	179.3	Zinc-finger double domain
11	PF13451 zf-trcl	9.6e+02	11.1	Probable zinc-ribbon domain
12	PF18439 zf_UBZ	47	15.1	Ubiquitin-Binding Zinc Finger
13	PF09723 Zn-ribbon_8	4.9	18.7	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378669	0.820	Fructose-bisphosphate aldolase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003676	0.607	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.809	regulation of cellular process
GO:0060255	0.758	regulation of macromolecule metabolic process
GO:0019219	0.726	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.716	negative regulation of biological process
GO:0009889	0.683	regulation of biosynthetic process
GO:0009892	0.674	negative regulation of metabolic process
GO:0051252	0.668	regulation of RNA metabolic process
GO:0009987	0.608	cellular process
GO:0000003	0.568	reproduction
GO:0032501	0.562	multicellular organismal process
GO:0010556	0.549	regulation of macromolecule biosynthetic process
GO:0010468	0.507	regulation of gene expression
GO:2001141	0.502	regulation of RNA biosynthetic process
GO:0006355	0.487	regulation of DNA-templated transcription
GO:0010605	0.468	negative regulation of macromolecule metabolic process
GO:0048523	0.464	negative regulation of cellular process
GO:0051172	0.455	negative regulation of nitrogen compound metabolic process
GO:0045892	0.451	negative regulation of DNA-templated transcription
GO:0071704	0.426	organic substance metabolic process
GO:0022414	0.381	reproductive process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0043232	0.943	intracellular non-membrane-bounded organelle
GO:0005615	0.928	extracellular space
GO:0031981	0.898	nuclear lumen
GO:0005829	0.861	cytosol
GO:0031982	0.756	vesicle
GO:0070062	0.748	extracellular exosome
GO:0005654	0.727	nucleoplasm
GO:0012505	0.453	endomembrane system
GO:0016020	0.421	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]