StarFunc result for job id Q9UIF8

User Input

>input (2168 residues)
MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSSTINPCGHLFRTAGDQPF
NLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWRTTD
AHTRTGATFFPPLLGIPPLFAPPAQNHDSSSFHSRTSGKSNRNGPEKGVNGSINGSNTSS
VIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAME
SSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQ
VLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVLSQQLPFIFQS
SQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEES
SLLTSELRSKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHP
NPFLTNALLGNHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTS
GRRTPGNQTPVMPSASPILHSQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPS
SKDSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDKDQDESD
SDTEGEKTSMKLNKTTSSVKSPSMSLTGHSTPRNLHIAKAPGSAPAALCSESQSPAFLGT
SSSTLTSSPHSGTSKRRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKL
RQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRA
MEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQ
IKLLRKLQKQEQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELR
AQQILEAKKKKKEEAANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEA
RKKAEEKERLKQEKRDEKRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRI
PGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLV
RLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQTELTESLKTK
AFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHA
KKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEED
KEDKKGKKTDICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQD
RYRRRYWILPQCGGIFVEGMESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSN
TDHCEQKEDLKEKDNTNLFLQKPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANGCTLSY
QNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFYSPLPNDQLLKTLTEKNRQWF
SLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKSPSPTPAPLGSSAQNPVGLNPFALSPL
QVKGGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSKSES
PVPQNEKATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIR
EKALQKQIQKHLDYITQACLKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVL
QQVEDLERRVASASLQVKGWMCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAH
ALERKSDNPLDIAVTRLADLERNIERRIEEDIAPGLRVWRRALSEARSAAQVALCIQQLQ
KSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIA
KASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGNKDLKKRKMEE
NTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKV
IKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKK
WTDTFKVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AUY4	0.380	0.387	0.000	2123	0.842	0.860	A2AUY4.pdb.gz	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
2	AFDB:Q9UIF8	1.000	1.000	0.000	2168	1.000	1.000	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
3	AFDB:Q9UIF9	0.262	0.294	2.478E-90	1905	0.287	0.327	Q9UIF9.pdb.gz	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
4	AFDB:Q91YE5	0.261	0.296	7.228E-89	1889	0.278	0.319	Q91YE5.pdb.gz	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
5	AFDB:P39769	0.044	0.057	1.452E-5	1589	0.099	0.135	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
6	AFDB:Q9VQM0	0.032	0.032	1.923E-5	2162	0.125	0.126	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
7	AFDB:Q8LK56	0.039	0.041	2.397E-3	1987	0.116	0.126	Q8LK56.pdb.gz	DME_ARATH Transcriptional activator DEMETER OS=Arabidopsis thaliana OX=3702 GN=DME PE=1 SV=2
8	AFDB:Q8BI84	0.041	0.045	2.512E-3	1930	0.128	0.144	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
9	AFDB:Q8NFD5	0.036	0.035	3.030E-3	2236	0.137	0.133	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
10	AFDB:P29617	0.045	0.047	3.655E-3	1703	0.113	0.143	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
11	PDB:7ao8C	0.022	0.596	9.515E-2	64	0.009	0.312	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	PDB:6q6gN	0.026	0.061	2.096	656	0.013	0.044	6q6gN.pdb.gz	Cyclin A2 degradation during the spindle assembly checkpoint requires multiple binding modes to the APC/C.
13	PDB:4k7gD	0.015	0.078	2.302	352	0.007	0.045	4k7gD.pdb.gz	Crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site
14	PDB:7lhfB	0.029	0.028	2.776	2300	0.016	0.015	7lhfB.pdb.gz	Cryo-EM structure of type 1 IP3R channel in a lipid bilayer
15	PDB:7ohvk	0.019	0.265	2.909	63	0.003	0.111	7ohvk.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
16	PDB:7b9kA	0.026	0.105	3.049	320	0.006	0.037	7b9kA.pdb.gz
17	PDB:7r5vN	0.020	0.084	3.049	297	0.005	0.037	7r5vN.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
18	PDB:6w6eI	0.014	0.055	4.435	357	0.006	0.036	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
19	PDB:6qldN	0.022	0.089	5.350	371	0.003	0.016	6qldN.pdb.gz	Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
20	PDB:1b8tA	0.021	0.155	5.606	192	0.010	0.109	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AUY4	0.0	3163	2123	0.837	0.854	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
2	Q9UIF8	0.0	4475	2168	1.000	1.000	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
3	F8VU39	4.32e-122	431	1903	0.101	0.115	F8VU39_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
4	Q9UIF9	4.42e-122	431	1905	0.101	0.114	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
5	J3KPG5	6.57e-122	431	1875	0.101	0.116	J3KPG5_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
6	Q91YE5	1.55e-119	423	1889	0.100	0.114	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
7	A8DYA3	6.52e-64	245	3131	0.084	0.058	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
8	A1Z8M2	9.95e-64	244	2999	0.084	0.061	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
9	A0A0B4KFE3	3.57e-58	226	3058	0.080	0.057	A0A0B4KFE3_DROME Toutatis, isoform F OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
10	A0A0B4KEM1	4.81e-57	223	3094	0.079	0.056	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
11	Q9BMQ0	1.14e-48	195	3109	0.075	0.052	Q9BMQ0_DROME Toutatis OS=Drosophila melanogaster OX=7227 GN=tou PE=3 SV=1
12	Q95T46	3.60e-37	143	249	0.028	0.241	Q95T46_DROME GH22615p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
13	Q960I3	3.84e-34	144	683	0.028	0.088	Q960I3_DROME LP06732p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
14	Q23590	1.43e-32	141	1390	0.049	0.076	BAZ2_CAEEL Bromodomain adjacent to zinc finger domain protein 2 OS=Caenorhabditis elegans OX=6239 GN=baz-2 PE=1 SV=4
15	O88379	2.26e-22	108	1555	0.023	0.032	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3
16	F1SHI5	5.39e-22	107	1557	0.024	0.033	F1SHI5_PIG Bromodomain adjacent to zinc finger domain 1A OS=Sus scrofa OX=9823 GN=BAZ1A PE=4 SV=2
17	Q9NRL2	5.77e-22	107	1556	0.024	0.033	BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2
18	Q32PZ6	7.41e-20	98.6	607	0.032	0.115	Q32PZ6_RAT Trim24 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Trim24 PE=2 SV=1
19	O15164	1.46e-19	99.0	1050	0.032	0.066	TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3
20	A0A8I6AI80	1.59e-19	98.6	1050	0.032	0.067	A0A8I6AI80_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	1.9e-17	74.4	Bromodomain
2	PF02791 DDT	3.5e-06	38.5	DDT domain
3	PF01429 MBD	4.5e-17	72.8	Methyl-CpG binding domain
4	PF00628 PHD	4.1e-08	44.3	PHD-finger
5	PF15612 WHIM1	2.2e+02	12.8	WSTF, HB1, Itc1p, MBD9 motif 1
6	PF15613 WSD	1.8e-08	46.2	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376534

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360162	0.823	Probable global transcription activator SNF2L1
2	9606.ENSP00000283131	0.808	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
3	9606.ENSP00000346175	0.788	Histone-lysine N-methyltransferase SETDB2
4	9606.ENSP00000476960	0.739	Histone cluster 2 H3 pseudogene 2
5	9606.ENSP00000385450	0.738	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
6	9606.ENSP00000363286	0.709	DNA polymerase epsilon subunit 3
7	9606.ENSP00000265872	0.686	Cell division cycle and apoptosis regulator protein 1
8	9606.ENSP00000278319	0.684	Zinc finger protein 215
9	9606.ENSP00000267485	0.674	Uncharacterized protein C14orf37
10	9606.ENSP00000335636	0.641	N-alpha-acetyltransferase 20
11	9606.ENSP00000278314	0.638	Zinc finger protein 214
12	9606.ENSP00000394794	0.628	Tyrosine-protein phosphatase non-receptor type 13
13	9606.ENSP00000287394	0.616	ATPase family AAA domain-containing protein 2
14	9606.ENSP00000418001	0.614	Glycerol kinase 5
15	9606.ENSP00000274849	0.609	Activator of basal transcription 1
16	9606.ENSP00000382204	0.606	Probable JmjC domain-containing histone demethylation protein 2C
17	9606.ENSP00000381823	0.605	Protein transport protein Sec24A
18	9606.ENSP00000370989	0.587	Programmed cell death 1 ligand 1
19	9606.ENSP00000238789	0.580	ATPase family, AAA domain containing 2B
20	9606.ENSP00000311825	0.570	C-terminal-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.459	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006325	0.990	chromatin organization
GO:0006338	0.828	chromatin remodeling
GO:0050794	0.706	regulation of cellular process
GO:0019222	0.614	regulation of metabolic process
GO:0060255	0.596	regulation of macromolecule metabolic process
GO:0080090	0.453	regulation of primary metabolic process
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:0048518	0.452	positive regulation of biological process
GO:0031323	0.441	regulation of cellular metabolic process
GO:0019219	0.424	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.416	positive regulation of cellular process
GO:0010468	0.387	regulation of gene expression
GO:0009889	0.353	regulation of biosynthetic process
GO:0051252	0.336	regulation of RNA metabolic process
GO:2001141	0.325	regulation of RNA biosynthetic process
GO:0006355	0.320	regulation of DNA-templated transcription
GO:0051173	0.308	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.970	nucleoplasm
GO:0043232	0.697	intracellular non-membrane-bounded organelle
GO:0000785	0.342	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]