StarFunc result for job id Q9UIF9

User Input

>input (1905 residues)
MEMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLST
VSHTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANPGSNLKDPPLLSQFSGGQ
YPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMP
NGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLEL
EEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLE
PFNSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATAFSLLADDSQT
STSIFASPTSPPVLGESVLQDNSFDLNNGSDAEQEEMETQSSDFPPSLTQPAPDQSSTIQ
LHPATSPAVSPTTSPAVSLVVSPAASPEISPEVCPAASTVVSPAVFSVVSPASSAVLPAV
SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGD
VMRRRIATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRN
VVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRIQAITGKRGRPRNTEK
AKTKEVPKVKRGRGRPPKVKITELLNKTDNRPLKKLEAQETLNEEDKAKIAKSKKKMRQK
VQRGECQTTIQGQARNKRKQETKSLKQKEAKKKSKAEKEKGKTKQEKLKEKVKREKKEKV
KMKEKEEVTKAKPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSR
VPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLL
VRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGVEPALCDRLRT
QPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVL
AKRTGRSEVEMEGPEECLGRRRSSRIMEETSGMEEEEEEESIAAVPGRRGRRDGEVDATA
SSIPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVEGTE
GNLVPEEVIKKETDSLKVAAHASLNPALFSMKMELAGSNTTASSPARARGRPRKTKPGSM
QPRHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQLQSHKGFLEQEGSPLSLGQS
QHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPAPSQPPEEPEPDEAESSPDPQ
ALWFNISAQMPCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPSAANPCSPVQFSSTPLA
GLAPKRRAGDPGEMPQSPTGLGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCSGWW
WIRDPEMLDAMLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFEPRQLPAFQEG
IMSWSPKEKTYETDLAVLQWVEELEQRVIMSDLQIRGWTCPSPDSTREDLAYCEHLSDSQ
EDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERRYLREPLWPTHEVVLEKALLS
TPNGAPEGTTTEISYEITPRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCL
VCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPK
RGQKRKSGYSLNFSEGDGRRRRVLLRGRESPAAGPRYSEEGLSPSKRRRLSMRNHHSDLT
FCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAA
DALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQGKQANL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91YE5	0.544	0.548	0.000	1889	0.840	0.847	Q91YE5.pdb.gz	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
2	AFDB:Q9UIF9	1.000	1.000	0.000	1905	1.000	1.000	Q9UIF9.pdb.gz	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
3	AFDB:Q9UIF8	0.312	0.278	1.476E-91	2168	0.318	0.280	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
4	AFDB:A2AUY4	0.340	0.308	7.270E-88	2123	0.312	0.280	A2AUY4.pdb.gz	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
5	AFDB:Q8IRB5	0.039	0.045	6.306E-6	1465	0.109	0.141	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
6	AFDB:Q9VW85	0.043	0.048	1.150E-5	1661	0.108	0.123	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
7	AFDB:A8DZ29	0.039	0.039	1.383E-5	1919	0.123	0.122	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
8	AFDB:D3ZRA6	0.039	0.043	3.650E-5	1683	0.127	0.144	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
9	AFDB:Q8IQT4	0.032	0.029	4.391E-5	2133	0.146	0.131	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
10	AFDB:C7IW64	0.046	0.045	1.331E-4	1952	0.140	0.136	C7IW64.pdb.gz	ROS1A_ORYSJ Protein ROS1A OS=Oryza sativa subsp. japonica OX=39947 GN=ROS1A PE=1 SV=2
11	PDB:7ao8C	0.025	0.609	1.100E-1	64	0.008	0.234	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	PDB:6w6eI	0.021	0.070	1.333	357	0.006	0.034	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
13	PDB:5fpnA	0.019	0.069	1.532	379	0.005	0.024	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
14	PDB:4v98AN	0.032	0.156	2.117	216	0.015	0.134	4v98AN.pdb.gz	Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
15	PDB:7ohvk	0.020	0.273	2.667	63	0.005	0.143	7ohvk.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
16	PDB:7ou2B	0.042	0.097	3.859	650	0.014	0.040	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
17	PDB:3duhC	0.032	0.145	4.233	137	0.014	0.190	3duhC.pdb.gz
18	PDB:6i00A	0.022	0.085	5.092	289	0.007	0.048	6i00A.pdb.gz
19	PDB:1x8zA	0.035	0.234	5.585	151	0.009	0.113	1x8zA.pdb.gz
20	PDB:7qskQ	0.023	0.170	5.585	129	0.010	0.147	7qskQ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VU39	0.0	3910	1903	0.999	1.000	F8VU39_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
2	J3KPG5	0.0	3841	1875	0.984	1.000	J3KPG5_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
3	Q91YE5	0.0	3066	1889	0.842	0.849	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
4	Q9UIF9	0.0	3913	1905	1.000	1.000	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
5	Q9UIF8	3.36e-144	498	2168	0.149	0.131	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
6	H0YHQ7	4.26e-123	390	277	0.110	0.755	H0YHQ7_HUMAN Bromodomain adjacent to zinc finger domain 2A (Fragment) OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
7	A2AUY4	1.96e-121	429	2123	0.135	0.121	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
8	A8DYA3	2.36e-40	167	3131	0.082	0.050	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
9	A1Z8M2	2.84e-40	167	2999	0.082	0.052	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
10	A0A0B4KEM1	5.69e-38	159	3094	0.080	0.049	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
11	Q23590	7.72e-37	155	1390	0.050	0.068	BAZ2_CAEEL Bromodomain adjacent to zinc finger domain protein 2 OS=Caenorhabditis elegans OX=6239 GN=baz-2 PE=1 SV=4
12	A0A0B4KFE3	1.54e-36	155	3058	0.079	0.049	A0A0B4KFE3_DROME Toutatis, isoform F OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
13	Q9BMQ0	4.07e-36	153	3109	0.081	0.050	Q9BMQ0_DROME Toutatis OS=Drosophila melanogaster OX=7227 GN=tou PE=3 SV=1
14	Q95T46	3.21e-31	126	249	0.028	0.217	Q95T46_DROME GH22615p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
15	Q960I3	1.63e-28	126	683	0.028	0.079	Q960I3_DROME LP06732p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
16	Q32PZ6	1.03e-23	110	607	0.038	0.119	Q32PZ6_RAT Trim24 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Trim24 PE=2 SV=1
17	Q9Z277	1.60e-23	111	1479	0.041	0.053	BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus OX=10090 GN=Baz1b PE=1 SV=2
18	Q9NRL2	4.25e-23	110	1556	0.049	0.060	BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2
19	O88379	7.67e-23	109	1555	0.029	0.035	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3
20	Q64127	1.47e-22	108	1051	0.038	0.069	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	3.6e-16	70.3	Bromodomain
2	PF02791 DDT	1.1e-06	40.1	DDT domain
3	PF01429 MBD	8.2e-17	72.0	Methyl-CpG binding domain
4	PF00628 PHD	3.1e-07	41.5	PHD-finger
5	PF15612 WHIM1	0.2	22.5	WSTF, HB1, Itc1p, MBD9 motif 1
6	PF15613 WSD	8.9e-12	56.8	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283131	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
2	9606.ENSP00000333920	0.997	Transcription termination factor 1
3	9606.ENSP00000296417	0.948	Histone H2A.Z
4	9606.ENSP00000362649	0.937	Histone deacetylase 1
5	9606.ENSP00000434024	0.936	Histone H2AX
6	9606.ENSP00000332194	0.932	Histone H2A type 2-C
7	9606.ENSP00000358151	0.926	Histone H2B type 2-E
8	9606.ENSP00000308405	0.920	Histone H2A.V
9	9606.ENSP00000328484	0.920	Histone H2A type 1-J
10	9606.ENSP00000289316	0.918	Histone H2B type 1-D
11	9606.ENSP00000438553	0.915	Histone H2A.J
12	9606.ENSP00000274764	0.914	Histone H2B type 1-A
13	9606.ENSP00000341094	0.914	Histone H2A type 1-D
14	9606.ENSP00000349430	0.914	Histone H2B type 1-K
15	9606.ENSP00000366618	0.914	Histone H2B type 1-L
16	9606.ENSP00000367022	0.914	Histone H2A type 1-C
17	9606.ENSP00000476136	0.914	Histone H2B type 1-J
18	9606.ENSP00000477527	0.914	Histone H2B type 1-O
19	9606.ENSP00000477907	0.914	Histone H2B type 1-M
20	9606.ENSP00000479169	0.914	Histone H2B type 1-H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.998	histone binding
GO:0001046	0.998	core promoter sequence-specific DNA binding
GO:0140030	0.709	modification-dependent protein binding
GO:0140033	0.689	acetylation-dependent protein binding
GO:0070577	0.661	lysine-acetylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.993	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.992	regulation of gene expression
GO:0010605	0.990	negative regulation of macromolecule metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0006338	0.989	chromatin remodeling
GO:0016570	0.989	histone modification
GO:0009889	0.984	regulation of biosynthetic process
GO:0090304	0.981	nucleic acid metabolic process
GO:0044260	0.975	cellular macromolecule metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0051052	0.958	regulation of DNA metabolic process
GO:0045934	0.956	negative regulation of nucleobase-containing compound metabolic process
GO:0009893	0.955	positive regulation of metabolic process
GO:0032259	0.954	methylation
GO:0010604	0.953	positive regulation of macromolecule metabolic process
GO:0040029	0.953	epigenetic regulation of gene expression
GO:0045892	0.953	negative regulation of DNA-templated transcription
GO:0048522	0.949	positive regulation of cellular process
GO:0051173	0.946	positive regulation of nitrogen compound metabolic process
GO:0031325	0.940	positive regulation of cellular metabolic process
GO:0045814	0.937	negative regulation of gene expression, epigenetic
GO:0031507	0.927	heterochromatin formation
GO:0043414	0.915	macromolecule methylation
GO:0031399	0.867	regulation of protein modification process
GO:0006259	0.863	DNA metabolic process
GO:0018193	0.851	peptidyl-amino acid modification
GO:0008213	0.840	protein alkylation
GO:0140718	0.817	facultative heterochromatin formation
GO:0018205	0.815	peptidyl-lysine modification
GO:0006479	0.809	protein methylation
GO:0006304	0.785	DNA modification
GO:0031056	0.784	regulation of histone modification
GO:0044030	0.777	regulation of DNA methylation
GO:0018022	0.662	peptidyl-lysine methylation
GO:0006305	0.632	DNA alkylation
GO:0031060	0.562	regulation of histone methylation
GO:0016571	0.516	histone methylation
GO:0034968	0.502	histone lysine methylation
GO:0051247	0.491	positive regulation of protein metabolic process
GO:0006997	0.475	nucleus organization
GO:0031401	0.411	positive regulation of protein modification process
GO:0006306	0.409	DNA methylation
GO:0031058	0.401	positive regulation of histone modification
GO:0007000	0.390	nucleolus organization
GO:0031062	0.383	positive regulation of histone methylation
GO:0006476	0.378	protein deacetylation
GO:0016575	0.363	histone deacetylation
GO:0006357	0.362	regulation of transcription by RNA polymerase II
GO:0045935	0.308	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.998	cytosol
GO:0016604	0.975	nuclear body
GO:0032991	0.947	protein-containing complex
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0016607	0.944	nuclear speck
GO:0005694	0.404	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]