StarFunc result for job id Q9UIG0

User Input

>input (1483 residues)
MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQL
THKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEEC
DFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVV
KEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHKYDVKLQNEDKIISNVPADS
LIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMT
LNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSPLKVKNSKNSK
SPEEHLEEMMKMMSPNKLHTNFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGN
SKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRAPRNSGGTPRTSSKPHKHLPPAALHLIA
YYKENKDREDKRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSE
EQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPE
GLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQ
TLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSDVQEESEGSDTDDNKDSAAFE
DNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKER
LAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMIS
AVKSRRLLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRR
TPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDEDYCPRSKKAN
LGKNASMNTQHGTATEVAVETTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKER
LEKRYQDIIHSIHLARKPNLGLKSCDGNQELLNFLRSDLIEVATRLQKGGLGYVEETSEF
EARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMV
EEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLI
LCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNSRGRNYTEESASEDSEDDESD
EEEEEEEEEEEEEDYEVAGLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAP
PVDDAEVDELVLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVI
THPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALL
HKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIG0	1.000	1.000	0.000	1483	1.000	1.000	Q9UIG0.pdb.gz	BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2
2	AFDB:Q9UIF8	0.235	0.175	1.793E-26	2168	0.192	0.131	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
3	AFDB:Q9BXF3	0.108	0.108	2.862E-5	1484	0.090	0.090	Q9BXF3.pdb.gz	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
4	AFDB:P34545	0.071	0.052	3.996E-4	2017	0.104	0.076	P34545.pdb.gz	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
5	AFDB:Q803V1	0.074	0.124	3.707E-3	863	0.040	0.068	Q803V1.pdb.gz
6	AFDB:Q6JHU9	0.073	0.050	5.581E-3	2442	0.118	0.072	Q6JHU9.pdb.gz	CBP_RAT Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1
7	AFDB:Q02875	0.038	0.054	5.933E-2	849	0.088	0.154	Q02875.pdb.gz	SYH1_YEAST SMY2 homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYH1 PE=1 SV=1
8	AFDB:Q8I492	0.047	0.048	1.173E-1	1434	0.120	0.124	Q8I492.pdb.gz	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
9	AFDB:Q9UPV0	0.039	0.039	2.913E-1	1460	0.142	0.144	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	PDB:5ikjA	0.047	0.141	5.282E-1	448	0.011	0.038	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
11	AFDB:Q9SU08	0.057	0.088	5.504E-1	904	0.101	0.166	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
12	PDB:7p7wBBB	0.035	0.111	3.406	306	0.011	0.052	7p7wBBB.pdb.gz	Structure and function of N-acetylglucosamine kinase illuminates the catalytic mechanism of ROK kinases
13	PDB:7w7gB	0.028	0.025	4.275	1711	0.011	0.009	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
14	PDB:7pubFh	0.044	0.138	4.900	274	0.013	0.069	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
15	PDB:6c0fD	0.038	0.197	5.128	190	0.013	0.100	6c0fD.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
16	PDB:1ng9A	0.028	0.043	6.436	794	0.017	0.031	1ng9A.pdb.gz	The alternating ATPase domains of MutS control DNA mismatch repair
17	PDB:7wrgB	0.030	0.048	6.736	783	0.012	0.023	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
18	PDB:5o9zH	0.047	0.124	7.049	413	0.017	0.061	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
19	PDB:6xu2A	0.024	0.031	7.049	1091	0.015	0.020	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:7r5jF0	0.021	0.069	7.049	241	0.014	0.087	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UIG0	0.0	3054	1483	1.000	1.000	BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2
2	Q9Z277	0.0	2655	1479	0.911	0.913	BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus OX=10090 GN=Baz1b PE=1 SV=2
3	A2AUY4	6.21e-27	122	2123	0.049	0.034	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
4	O88379	6.63e-21	102	1555	0.096	0.091	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3
5	F1SHI5	8.77e-21	102	1557	0.098	0.093	F1SHI5_PIG Bromodomain adjacent to zinc finger domain 1A OS=Sus scrofa OX=9823 GN=BAZ1A PE=4 SV=2
6	Q9NRL2	1.59e-18	95.1	1556	0.028	0.026	BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2
7	Q9UIF8	1.67e-18	95.1	2168	0.049	0.033	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
8	Q5BI37	1.93e-18	94.4	1151	0.024	0.031	Q5BI37_DROME LD32807p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
9	Q9V9T4	2.76e-18	94.0	1476	0.024	0.024	Q9V9T4_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=1 SV=1
10	Q9NG24	2.93e-18	94.0	1476	0.024	0.024	Q9NG24_DROME Chromatin accessibility complex (CHRAC) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
11	Q9Y0W1	3.94e-18	93.6	1476	0.024	0.024	Q9Y0W1_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
12	A1Z8M2	3.05e-17	90.9	2999	0.020	0.010	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
13	Q960I3	2.55e-16	87.0	683	0.020	0.044	Q960I3_DROME LP06732p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
14	Q95RV8	7.07e-14	77.8	400	0.043	0.160	Q95RV8_DROME LD09043p OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
15	J3KPG5	2.68e-13	77.8	1875	0.019	0.015	J3KPG5_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
16	F8VU39	2.76e-13	77.8	1903	0.019	0.015	F8VU39_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
17	Q9UIF9	2.81e-13	77.8	1905	0.019	0.015	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
18	F4K6Q7	4.07e-13	76.6	689	0.022	0.046	F4K6Q7_ARATH Bromodomain and extraterminal domain protein 9 OS=Arabidopsis thaliana OX=3702 GN=BET9 PE=1 SV=1
19	Q91YE5	4.16e-13	77.4	1889	0.018	0.014	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
20	Q93YS6	4.32e-13	76.6	688	0.022	0.047	GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana OX=3702 GN=GTE9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	5.5e-17	72.9	Bromodomain
2	PF02791 DDT	11	17.7	DDT domain
3	PF00628 PHD	1e-09	49.5	PHD-finger
4	PF13831 PHD_2	1e+02	13.8	PHD-finger
5	PF10537 WAC_Acf1_DNA_bd	5.1e-21	86.4	ATP-utilising chromatin assembly and remodelling N-terminal
6	PF15612 WHIM1	0.00031	31.5	WSTF, HB1, Itc1p, MBD9 motif 1
7	PF15613 WSD	3e-18	77.5	Williams-Beuren syndrome DDT (WSD), D-TOX E motif
8	PF12861 zf-ANAPC11	68	14.9	Anaphase-promoting complex subunit 11 RING-H2 finger
9	PF13771 zf-HC5HC2H	21	16.8	PHD-like zinc-binding domain
10	PF12678 zf-rbx1	2.2e+02	13.6	RING-H2 zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283131	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
2	9606.ENSP00000254480	0.988	SWI/SNF complex subunit SMARCC1
3	9606.ENSP00000395654	0.986	Transcription activator BRG1
4	9606.ENSP00000434024	0.985	Histone H2AX
5	9606.ENSP00000267064	0.984	SWI/SNF complex subunit SMARCC2
6	9606.ENSP00000447173	0.982	Vitamin D3 receptor
7	9606.ENSP00000396704	0.972	DNA topoisomerase 2-beta
8	9606.ENSP00000216297	0.962	FACT complex subunit SPT16
9	9606.ENSP00000397552	0.957	Actin-like protein 6A
10	9606.ENSP00000320485	0.956	AT-rich interactive domain-containing protein 1A
11	9606.ENSP00000352834	0.950	Unconventional myosin-Ic
12	9606.ENSP00000323967	0.947	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
13	9606.ENSP00000378414	0.943	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
14	9606.ENSP00000358151	0.937	Histone H2B type 2-E
15	9606.ENSP00000332194	0.936	Histone H2A type 2-C
16	9606.ENSP00000296417	0.927	Histone H2A.Z
17	9606.ENSP00000301280	0.926	Chromatin assembly factor 1 subunit A
18	9606.ENSP00000479169	0.922	Histone H2B type 1-H
19	9606.ENSP00000308405	0.921	Histone H2A.V
20	9606.ENSP00000484261	0.919	Histone H2A-Bbd type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.997	histone binding
GO:0035173	0.996	histone kinase activity
GO:0004715	0.992	non-membrane spanning protein tyrosine kinase activity
GO:0097159	0.578	organic cyclic compound binding
GO:1901363	0.577	heterocyclic compound binding
GO:0140801	0.571	histone H2AY142 kinase activity
GO:0003676	0.562	nucleic acid binding
GO:0003677	0.454	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006325	0.998	chromatin organization
GO:0050794	0.997	regulation of cellular process
GO:0006338	0.985	chromatin remodeling
GO:0080135	0.979	regulation of cellular response to stress
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:2001020	0.962	regulation of response to DNA damage stimulus
GO:0048518	0.938	positive regulation of biological process
GO:0080090	0.936	regulation of primary metabolic process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0048522	0.934	positive regulation of cellular process
GO:0019219	0.929	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.909	metabolic process
GO:0010556	0.898	regulation of macromolecule biosynthetic process
GO:0031326	0.896	regulation of cellular biosynthetic process
GO:0006355	0.891	regulation of DNA-templated transcription
GO:0009893	0.890	positive regulation of metabolic process
GO:0006807	0.888	nitrogen compound metabolic process
GO:0031325	0.883	positive regulation of cellular metabolic process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0044238	0.861	primary metabolic process
GO:0071704	0.859	organic substance metabolic process
GO:0048519	0.858	negative regulation of biological process
GO:0043170	0.848	macromolecule metabolic process
GO:0045935	0.846	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.844	negative regulation of cellular process
GO:0050896	0.731	response to stimulus
GO:0031328	0.722	positive regulation of cellular biosynthetic process
GO:1901564	0.717	organonitrogen compound metabolic process
GO:0010557	0.684	positive regulation of macromolecule biosynthetic process
GO:0051254	0.677	positive regulation of RNA metabolic process
GO:0051716	0.675	cellular response to stimulus
GO:0036211	0.656	protein modification process
GO:1902680	0.603	positive regulation of RNA biosynthetic process
GO:0045893	0.585	positive regulation of DNA-templated transcription
GO:0006950	0.500	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0005654	0.999	nucleoplasm
GO:1902494	0.998	catalytic complex
GO:0140513	0.998	nuclear protein-containing complex
GO:0070603	0.991	SWI/SNF superfamily-type complex
GO:0031010	0.966	ISWI-type complex
GO:0005730	0.749	nucleolus
GO:0098687	0.725	chromosomal region
GO:0000228	0.677	nuclear chromosome
GO:0000792	0.543	heterochromatin
GO:0110016	0.496	B-WICH complex
GO:0005657	0.460	replication fork
GO:0005737	0.375	cytoplasm
GO:0090535	0.372	WICH complex
GO:0000775	0.347	chromosome, centromeric region
GO:0043596	0.345	nuclear replication fork
GO:0000793	0.338	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.10.2	0.992	non-specific protein-tyrosine kinase.

[back to server]