StarFunc result for job id Q9UIH9

User Input

>input (416 residues)
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIH9	1.000	1.000	2.282E-68	416	1.000	1.000	Q9UIH9.pdb.gz	KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens OX=9606 GN=KLF15 PE=1 SV=1
2	AFDB:Q5FVT6	0.447	0.448	1.944E-55	415	0.837	0.839	Q5FVT6.pdb.gz	Q5FVT6_RAT Klf15 protein OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
3	AFDB:Q64HY5	0.208	0.181	8.814E-13	480	0.274	0.237	Q64HY5.pdb.gz	SP8_CHICK Transcription factor Sp8 OS=Gallus gallus OX=9031 GN=SP8 PE=2 SV=1
4	AFDB:Q8IXZ3	0.216	0.184	6.974E-12	490	0.264	0.224	Q8IXZ3.pdb.gz	SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens OX=9606 GN=SP8 PE=1 SV=3
5	AFDB:R9PY21	0.221	0.131	7.550E-11	720	0.269	0.156	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
6	AFDB:P11161	0.198	0.174	4.950E-10	476	0.264	0.231	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
7	AFDB:A0A0A0MT54	0.201	0.161	6.360E-10	522	0.286	0.228	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
8	AFDB:Q9PUT7	0.201	0.199	6.772E-10	419	0.219	0.217	Q9PUT7.pdb.gz	Q9PUT7_DANRE WT1 transcription factor a OS=Danio rerio OX=7955 GN=wt1 PE=2 SV=1
9	AFDB:P08152	0.205	0.182	7.676E-10	470	0.255	0.226	P08152.pdb.gz	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
10	AFDB:A0A2R8YDQ5	0.203	0.131	1.210E-8	659	0.214	0.135	A0A2R8YDQ5.pdb.gz	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
11	PDB:6enyG	0.047	0.052	4.398	365	0.017	0.019	6enyG.pdb.gz	Structure of the human MHC-I peptide-loading complex.
12	PDB:6raz2	0.039	0.031	4.398	559	0.014	0.011	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
13	PDB:3htxD	0.072	0.041	4.985	795	0.017	0.009	3htxD.pdb.gz	Structural insights into mechanisms of the small RNA methyltransferase HEN1.
14	PDB:5n0cA	0.054	0.021	4.985	1293	0.019	0.006	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
15	PDB:6sh3A	0.041	0.044	5.308	376	0.007	0.008	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
16	PDB:1mm4A	0.057	0.113	5.651	170	0.019	0.047	1mm4A.pdb.gz
17	PDB:5mrcQ	0.057	0.080	5.651	284	0.062	0.092	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:6gylQ	0.085	0.198	5.651	148	0.022	0.061	6gylQ.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
19	PDB:6sueA	0.068	0.014	5.651	2292	0.017	0.003	6sueA.pdb.gz
20	PDB:7o4iW	0.049	0.059	5.651	312	0.024	0.032	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FVT6	0.0	635	415	0.837	0.839	Q5FVT6_RAT Klf15 protein OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
2	Q9EPW2	0.0	657	415	0.849	0.851	KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus OX=10090 GN=Klf15 PE=1 SV=1
3	Q9UIH9	0.0	838	416	1.000	1.000	KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens OX=9606 GN=KLF15 PE=1 SV=1
4	Q9WTQ3	0.0	635	415	0.837	0.839	Q9WTQ3_RAT Kruppel-like transcription factor OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
5	E9QG09	2.63e-40	150	429	0.168	0.163	E9QG09_DANRE Krueppel-like factor 5 OS=Danio rerio OX=7955 GN=pibf1 PE=4 SV=1
6	Q13887	3.49e-39	148	457	0.144	0.131	KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5 PE=1 SV=2
7	Q5T6X2	3.49e-39	148	457	0.144	0.131	Q5T6X2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=KLF5 PE=2 SV=1
8	Q66HP1	6.66e-39	145	363	0.142	0.163	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
9	Q0IGQ2	7.49e-39	144	311	0.168	0.225	Q0IGQ2_DROME Kruppel-like factor 15 OS=Drosophila melanogaster OX=7227 GN=Klf15 PE=2 SV=2
10	Q9Z0Z7	1.48e-38	146	446	0.142	0.132	KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus OX=10090 GN=Klf5 PE=1 SV=2
11	F1LSL7	2.27e-38	145	443	0.142	0.133	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2
12	Q9VZN4	1.03e-36	144	751	0.144	0.080	DAR1_DROME Dendritic arbor reduction protein 1 OS=Drosophila melanogaster OX=7227 GN=dar1 PE=2 SV=2
13	Q13118	1.27e-36	141	480	0.207	0.179	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
14	Q90XE6	2.35e-36	138	365	0.144	0.164	KLF1_DANRE Kruppel-like factor 1 OS=Danio rerio OX=7955 GN=klf1 PE=2 SV=1
15	D4A4V3	4.15e-36	137	344	0.130	0.157	D4A4V3_RAT Kruppel like factor 3 OS=Rattus norvegicus OX=10116 GN=Klf3 PE=1 SV=1
16	O89091	4.48e-36	140	479	0.185	0.161	KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus OX=10090 GN=Klf10 PE=1 SV=1
17	Q60980	4.51e-36	137	344	0.130	0.157	KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus OX=10090 GN=Klf3 PE=1 SV=1
18	O95600	4.94e-36	137	359	0.130	0.150	KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens OX=9606 GN=KLF8 PE=1 SV=2
19	Q9W1W2	5.24e-36	137	362	0.137	0.157	Q9W1W2_DROME C2H2-type domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG9895 PE=4 SV=2
20	P57682	6.01e-36	137	345	0.130	0.157	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09986 DUF2225	3.1e+02	12.5	Uncharacterized protein conserved in bacteria (DUF2225)
2	PF19126 DUF5810	2.7	19.5	Family of unknown function (DUF5810)
3	PF16159 FOXP-CC	0.019	26.7	FOXP coiled-coil domain
4	PF00096 zf-C2H2	5e-12	56.7	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	7.6e-07	40.4	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	9.4e+02	11.6	C2H2-type zinc ribbon
7	PF16293 zf-C2H2_9	17	16.7	C2H2 type zinc-finger (1 copy)
8	PF05605 zf-Di19	7.8e+02	11.8	Drought induced 19 protein (Di19), zinc-binding
9	PF13465 zf-H2C2_2	1.1e-09	49.5	Zinc-finger double domain
10	PF12874 zf-met	6.8	18.4	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.955	Histone acetyltransferase p300
2	9606.ENSP00000384517	0.944	Aryl hydrocarbon receptor nuclear translocator-like protein 1
3	9606.ENSP00000338283	0.927	Neuronal PAS domain-containing protein 2
4	9606.ENSP00000308741	0.923	Circadian locomoter output cycles protein kaput
5	9606.ENSP00000344749	0.814	Cilia- and flagella-associated protein 100
6	9606.ENSP00000345359	0.812	Podocalyxin-like protein 2
7	9606.ENSP00000376930	0.812	Endoplasmic reticulum membrane protein that promotes endoplasmic reticulum-associated endosome fission . Localizes to contact sites between the endoplasmic reticulum and endosomes and acts by promoting recruitment of the endoplasmic reticulum to endosome tubules for fission . Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane .
8	9606.ENSP00000231509	0.735	Glucocorticoid receptor
9	9606.ENSP00000332771	0.725	Chloride channel protein ClC-Ka
10	9606.ENSP00000364831	0.720	Chloride channel protein ClC-Kb
11	9606.ENSP00000346389	0.710	Myocyte-specific enhancer factor 2A
12	9606.ENSP00000360412	0.681	Nucleolar complex protein 3 homolog
13	9606.ENSP00000317128	0.656	Plexin-D1
14	9606.ENSP00000427514	0.642	CCAAT/enhancer-binding protein alpha
15	9606.ENSP00000322991	0.615	Branched-chain-amino-acid aminotransferase, mitochondrial
16	9606.ENSP00000377061	0.608	Plexin-A1
17	9606.ENSP00000364946	0.572	Homeobox protein Mohawk
18	9606.ENSP00000230122	0.551	Zinc finger and BTB domain-containing protein 24
19	9606.ENSP00000368880	0.545	Forkhead box protein O1
20	9606.ENSP00000305422	0.536	CCAAT/enhancer-binding protein beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0001228	0.996	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.990	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.980	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.974	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0009987	0.981	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0006355	0.969	regulation of DNA-templated transcription
GO:0050896	0.951	response to stimulus
GO:0048518	0.910	positive regulation of biological process
GO:0048522	0.878	positive regulation of cellular process
GO:0006357	0.863	regulation of transcription by RNA polymerase II
GO:0045893	0.860	positive regulation of DNA-templated transcription
GO:0048519	0.828	negative regulation of biological process
GO:0051716	0.803	cellular response to stimulus
GO:0042221	0.752	response to chemical
GO:0045944	0.735	positive regulation of transcription by RNA polymerase II
GO:0010033	0.728	response to organic substance
GO:0009719	0.702	response to endogenous stimulus
GO:1901700	0.685	response to oxygen-containing compound
GO:0010243	0.684	response to organonitrogen compound
GO:0010605	0.674	negative regulation of macromolecule metabolic process
GO:0051172	0.672	negative regulation of nitrogen compound metabolic process
GO:0070887	0.652	cellular response to chemical stimulus
GO:1901652	0.637	response to peptide
GO:0048523	0.627	negative regulation of cellular process
GO:0031399	0.582	regulation of protein modification process
GO:1901983	0.513	regulation of protein acetylation
GO:0032501	0.477	multicellular organismal process
GO:0071310	0.456	cellular response to organic substance
GO:0031324	0.391	negative regulation of cellular metabolic process
GO:0032502	0.362	developmental process
GO:1901653	0.358	cellular response to peptide

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.745	cytoplasm
GO:0016604	0.424	nuclear body
GO:0016607	0.322	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]