StarFunc result for job id Q9UII4

User Input

>input (1024 residues)
MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSP
GRLAVLERGGAGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFE
YDNYSMKHLRFESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTT
TPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGL
DNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQI
ACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEELKLESHTSEKE
LIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFS
SPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFH
SPPQEALEIFFLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFS
KLVQMFKTAVICQLDYWDESAEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHR
LNFFVEVCRRYLWKMTVDASENVQCCVIFSHFPFIFNNLSKIKLLHTDTLLKIESKKHKA
YLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGY
DLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLSLFN
CNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHW
DRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLF
HPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLT
GTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNN
RGFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UII4	1.000	1.000	0.000	1024	1.000	1.000	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
2	AFDB:Q8IVU3	0.841	0.843	1.194E-92	1022	0.483	0.484	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
3	AFDB:F2Z461	0.822	0.838	1.296E-83	1003	0.424	0.433	F2Z461.pdb.gz	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
4	AFDB:Q5GLZ8	0.759	0.738	3.914E-79	1057	0.346	0.335	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
5	AFDB:E8NHA2	0.634	0.616	4.134E-73	1062	0.329	0.317	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
6	AFDB:Q9VTH1	0.502	0.526	1.186E-34	973	0.171	0.180	Q9VTH1.pdb.gz	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
7	AFDB:Q05086	0.489	0.562	7.985E-34	875	0.176	0.206	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
8	AFDB:Q5U5R9	0.480	0.612	1.343E-33	776	0.155	0.205	Q5U5R9.pdb.gz	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
9	AFDB:P40985	0.473	0.533	4.721E-33	892	0.171	0.196	P40985.pdb.gz	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
10	AFDB:O94275	0.486	0.599	1.442E-30	807	0.150	0.191	O94275.pdb.gz	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
11	PDB:8gqeB	0.277	0.709	5.369E-22	386	0.095	0.251	8gqeB.pdb.gz
12	PDB:5xgsA	0.271	0.667	1.264E-19	398	0.082	0.211	5xgsA.pdb.gz
13	PDB:7jq9A	0.224	0.107	6.284E-19	2427	0.121	0.051	7jq9A.pdb.gz
14	PDB:7mopA	0.211	0.094	1.257E-18	2445	0.119	0.050	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
15	PDB:5tbkI	0.276	0.649	1.250E-17	419	0.080	0.196	5tbkI.pdb.gz
16	PDB:5t94A	0.266	0.574	2.714E-16	454	0.074	0.167	5t94A.pdb.gz
17	PDB:4d4oA	0.243	0.568	8.941E-12	414	0.045	0.111	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
18	PDB:7ajtUO	0.178	0.329	1.185E-7	493	0.066	0.138	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7d4iBE	0.095	0.107	1.677E-7	890	0.086	0.099	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
20	PDB:6qk7A	0.119	0.109	2.477E-7	1161	0.083	0.073	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2Z461	0.0	811	1003	0.429	0.438	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
2	Q5GLZ8	0.0	616	1057	0.351	0.340	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
3	Q6PAV2	0.0	627	1057	0.343	0.332	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
4	Q8IVU3	0.0	947	1022	0.495	0.496	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
5	Q9UII4	0.0	2137	1024	1.000	1.000	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
6	E8NHA2	5.34e-165	515	1062	0.334	0.322	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
7	F1M7B8	1.58e-62	231	868	0.146	0.172	F1M7B8_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
8	A0A8I5ZM14	2.38e-62	230	867	0.146	0.172	A0A8I5ZM14_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1
9	Q05086	4.58e-62	229	875	0.136	0.159	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
10	O08759	6.31e-62	229	870	0.144	0.169	UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus OX=10090 GN=Ube3a PE=1 SV=2
11	Q9VTH1	2.24e-59	223	973	0.135	0.142	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
12	Q5U5R9	2.99e-53	202	776	0.119	0.157	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
13	P40985	2.85e-50	194	892	0.126	0.145	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
14	Q3KRP0	2.91e-47	185	910	0.109	0.123	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
15	O94275	1.81e-46	182	807	0.128	0.162	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
16	A0A0G2JTH7	8.80e-43	170	760	0.110	0.149	A0A0G2JTH7_RAT Ubiquitin protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
17	Q9P2P5	7.44e-41	166	1572	0.102	0.066	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
18	Q5U1Z5	8.14e-41	158	440	0.104	0.243	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
19	Q62940	2.29e-40	163	887	0.098	0.113	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
20	P46935	4.19e-40	162	887	0.100	0.115	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	5e-60	215.1	HECT-domain (ubiquitin-transferase)
2	PF03575 Peptidase_S51	1.8e+02	13.2	Peptidase family S51
3	PF00415 RCC1	4.8e-54	192.1	Regulator of chromosome condensation (RCC1) repeat
4	PF13540 RCC1_2	3.1e-28	108.2	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264350

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368699	0.995	Ubiquitin-like protein ISG15
2	9606.ENSP00000360869	0.992	Interferon-induced protein with tetratricopeptide repeats 1
3	9606.ENSP00000381601	0.992	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000333657	0.982	Interferon-induced GTP-binding protein Mx2
5	9606.ENSP00000233057	0.978	Interferon-induced, double-stranded RNA-activated protein kinase
6	9606.ENSP00000354394	0.976	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000287156	0.965	Ubiquitin/ISG15-conjugating enzyme E2 L6
8	9606.ENSP00000323889	0.957	E3 ubiquitin/ISG15 ligase TRIM25
9	9606.ENSP00000471896	0.954	Interferon regulatory factor 3
10	9606.ENSP00000369217	0.952	E3 ubiquitin-protein ligase ARIH1
11	9606.ENSP00000369213	0.939	Probable ATP-dependent RNA helicase DDX58
12	9606.ENSP00000343204	0.937	Tyrosine-protein kinase JAK1
13	9606.ENSP00000371471	0.930	Radical S-adenosyl methionine domain-containing protein 2
14	9606.ENSP00000333266	0.925	Ubiquitin-like modifier-activating enzyme 7
15	9606.ENSP00000360883	0.924	Interferon-induced protein with tetratricopeptide repeats 3
16	9606.ENSP00000359787	0.921	Interferon-induced protein 44-like
17	9606.ENSP00000359783	0.919	Interferon-induced protein 44
18	9606.ENSP00000257570	0.916	2'-5'-oligoadenylate synthase-like protein
19	9606.ENSP00000360891	0.915	Interferon-induced protein with tetratricopeptide repeats 2
20	9606.ENSP00000215794	0.912	Ubl carboxyl-terminal hydrolase 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0048583	0.982	regulation of response to stimulus
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0044238	0.974	primary metabolic process
GO:0065009	0.959	regulation of molecular function
GO:0032101	0.942	regulation of response to external stimulus
GO:0080134	0.939	regulation of response to stress
GO:0006807	0.928	nitrogen compound metabolic process
GO:0002831	0.921	regulation of response to biotic stimulus
GO:0051246	0.920	regulation of protein metabolic process
GO:0031347	0.914	regulation of defense response
GO:0043170	0.898	macromolecule metabolic process
GO:0019538	0.889	protein metabolic process
GO:0009987	0.884	cellular process
GO:0043412	0.877	macromolecule modification
GO:0070647	0.860	protein modification by small protein conjugation or removal
GO:0016567	0.844	protein ubiquitination
GO:0031399	0.831	regulation of protein modification process
GO:0050790	0.809	regulation of catalytic activity
GO:0051726	0.719	regulation of cell cycle
GO:0019220	0.712	regulation of phosphate metabolic process
GO:0050688	0.707	regulation of defense response to virus
GO:0051338	0.700	regulation of transferase activity
GO:0001932	0.696	regulation of protein phosphorylation
GO:0071900	0.692	regulation of protein serine/threonine kinase activity
GO:0000079	0.663	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0050896	0.632	response to stimulus
GO:0048518	0.425	positive regulation of biological process
GO:0048519	0.405	negative regulation of biological process
GO:0048523	0.309	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005654	0.901	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]