StarFunc result for job id Q9UIJ7

User Input

>input (227 residues)
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFI
DQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEV
IKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQT
KPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29411	0.988	0.988	4.748E-44	227	0.907	0.907	P29411.pdb.gz	KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=2 SV=2
2	PDB:6zjbD	0.931	0.969	1.008E-39	218	0.960	1.000	6zjbD.pdb.gz	Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
3	AFDB:F1R4S7	0.941	0.950	2.635E-36	225	0.648	0.653	F1R4S7.pdb.gz	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
4	AFDB:Q9WUS0	0.922	0.938	4.418E-34	223	0.577	0.587	Q9WUS0.pdb.gz	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
5	AFDB:P27144	0.849	0.863	1.582E-31	223	0.573	0.583	P27144.pdb.gz	KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
6	AFDB:Q9VGU6	0.904	0.949	3.291E-30	216	0.471	0.495	Q9VGU6.pdb.gz	Q9VGU6_DROME GTP:AMP phosphotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ak3 PE=1 SV=1
7	PDB:2ar7A	0.648	0.664	5.871E-29	221	0.577	0.593	2ar7A.pdb.gz
8	AFDB:P26364	0.855	0.862	4.862E-28	225	0.405	0.409	P26364.pdb.gz	KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK2 PE=1 SV=1
9	AFDB:Q5BGS1	0.878	0.846	2.028E-26	236	0.423	0.407	Q5BGS1.pdb.gz	Q5BGS1_EMENI GTP:AMP phosphotransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ADK2 PE=3 SV=1
10	AFDB:P33075	0.857	0.883	1.534E-25	220	0.396	0.409	P33075.pdb.gz	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
11	AFDB:P07170	0.862	0.880	3.718E-25	222	0.392	0.401	P07170.pdb.gz	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
12	AFDB:Q9FK35	0.829	0.763	4.788E-25	248	0.423	0.387	Q9FK35.pdb.gz	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
13	PDB:3tlxB	0.840	0.797	5.150E-24	240	0.366	0.346	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
14	PDB:3ndpB	0.630	0.687	1.943E-23	206	0.524	0.578	3ndpB.pdb.gz
15	PDB:1akeA	0.820	0.866	1.470E-22	214	0.379	0.402	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
16	PDB:2c9yA	0.654	0.677	3.258E-21	218	0.396	0.413	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
17	PDB:1dvrA	0.747	0.768	1.017E-20	220	0.374	0.386	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
18	PDB:2c95A	0.733	0.847	1.618E-16	195	0.247	0.287	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
19	PDB:2cdnA	0.705	0.854	2.083E-16	186	0.273	0.333	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
20	PDB:1ukyA	0.713	0.817	1.479E-15	196	0.225	0.260	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UIJ7	1.22e-169	468	227	1.000	1.000	KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4
2	Q9WTP7	2.03e-157	437	227	0.925	0.925	KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus OX=10090 GN=Ak3 PE=1 SV=3
3	P29411	1.75e-151	422	227	0.907	0.907	KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=2 SV=2
4	F1R4S7	1.86e-109	315	225	0.639	0.644	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
5	Q9WUS0	9.20e-99	288	223	0.573	0.583	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
6	Q9WUR9	1.13e-98	288	223	0.581	0.592	KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus OX=10090 GN=Ak4 PE=1 SV=1
7	P27144	8.12e-98	286	223	0.581	0.592	KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
8	Q9VGU6	3.43e-76	231	216	0.471	0.495	Q9VGU6_DROME GTP:AMP phosphotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ak3 PE=1 SV=1
9	F8VS11	1.21e-73	223	171	0.449	0.596	F8VS11_HUMAN Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
10	Q9FK35	6.72e-57	182	248	0.410	0.375	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
11	O82514	1.85e-56	181	246	0.388	0.358	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
12	P54819	2.79e-56	181	239	0.392	0.372	KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2
13	Q08479	5.05e-56	180	241	0.379	0.357	KAD3_ORYSJ Adenylate kinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-A PE=2 SV=1
14	Q38BZ2	5.24e-56	179	222	0.374	0.383	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
15	P07170	1.26e-55	178	222	0.396	0.405	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
16	P33075	5.49e-55	177	220	0.392	0.405	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
17	Q08480	1.30e-54	177	243	0.370	0.346	KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-B PE=2 SV=1
18	Q5BGS1	3.41e-54	175	236	0.414	0.398	Q5BGS1_EMENI GTP:AMP phosphotransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ADK2 PE=3 SV=1
19	I1XB05	4.02e-54	175	242	0.392	0.368	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
20	P29410	7.96e-54	174	239	0.379	0.360	KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	6e-15	67.3	AAA domain
2	PF13238 AAA_18	0.00064	31.7	AAA domain
3	PF13671 AAA_33	1.7e+02	13.8	AAA domain
4	PF00406 ADK	8.1e-48	173.8	Adenylate kinase
5	PF05191 ADK_lid	3.7e-13	60.5	Adenylate kinase, active site lid
6	PF02224 Cytidylate_kin	2.3e+02	12.9	Cytidylate kinase
7	PF18751 Ploopntkinase3	3.2e+02	12.3	P-loop Nucleotide Kinase3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219479	0.974	Nucleoside diphosphate kinase, mitochondrial
2	9606.ENSP00000373674	0.970	5'(3')-deoxyribonucleotidase, mitochondrial
3	9606.ENSP00000286621	0.953	Adenosine kinase
4	9606.ENSP00000367615	0.944	Adenine phosphoribosyltransferase
5	9606.ENSP00000410186	0.939	Adenylate kinase 9
6	9606.ENSP00000485525	0.934	Adenylosuccinate lyase
7	9606.ENSP00000320171	0.930	Pyruvate kinase PKM
8	9606.ENSP00000416658	0.930	Nucleoside diphosphate kinase 6
9	9606.ENSP00000376889	0.923	Nucleoside diphosphate kinase
10	9606.ENSP00000256578	0.921	AMP deaminase 2
11	9606.ENSP00000376886	0.921	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
12	9606.ENSP00000219302	0.920	Nucleoside diphosphate kinase 3
13	9606.ENSP00000251810	0.918	Ribonucleoside-diphosphate reductase subunit M2 B
14	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
15	9606.ENSP00000379802	0.917	AMP deaminase 3
16	9606.ENSP00000430075	0.917	AMP deaminase 1
17	9606.ENSP00000332116	0.915	cAMP-specific 3',5'-cyclic phosphodiesterase 4B
18	9606.ENSP00000345502	0.914	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
19	9606.ENSP00000339933	0.913	Pyruvate kinase PKLR
20	9606.ENSP00000337060	0.912	Nucleoside diphosphate kinase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004017	0.999	adenylate kinase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009123	0.985	nucleoside monophosphate metabolic process
GO:0046033	0.981	AMP metabolic process
GO:0090407	0.847	organophosphate biosynthetic process
GO:0009141	0.842	nucleoside triphosphate metabolic process
GO:0050896	0.783	response to stimulus
GO:1901293	0.718	nucleoside phosphate biosynthetic process
GO:0009205	0.658	purine ribonucleoside triphosphate metabolic process
GO:0065007	0.560	biological regulation
GO:0032501	0.385	multicellular organismal process
GO:0009165	0.316	nucleotide biosynthetic process
GO:0050794	0.308	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	1.000	intracellular organelle lumen
GO:0005759	0.985	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12973	0.999	AMP + ATP = 2 ADP
EC:2.7.4.3	0.999	adenylate kinase.

[back to server]