StarFunc result for job id Q9UIK4

User Input

>input (370 residues)
MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R603	0.922	0.922	6.753E-70	370	1.000	1.000	A0A024R603.pdb.gz
2	PDB:2yaaA	0.804	0.990	3.025E-55	300	0.792	0.977	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
3	AFDB:Q80YE7	0.842	0.220	5.961E-53	1442	0.651	0.167	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
4	AFDB:E9QHI3	0.786	0.643	1.335E-49	453	0.605	0.494	E9QHI3.pdb.gz	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
5	AFDB:O43293	0.790	0.645	2.623E-49	454	0.605	0.493	O43293.pdb.gz	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
6	AFDB:O54784	0.784	0.650	1.269E-48	448	0.608	0.502	O54784.pdb.gz	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
7	AFDB:O01653	0.773	0.356	4.524E-33	832	0.357	0.159	O01653.pdb.gz	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
8	AFDB:B1H1J7	0.745	0.641	2.315E-32	433	0.324	0.277	B1H1J7.pdb.gz	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
9	AFDB:A1ZA70	0.769	0.399	5.093E-32	732	0.349	0.176	A1ZA70.pdb.gz	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
10	AFDB:A1ZA69	0.768	0.318	5.700E-32	929	0.343	0.137	A1ZA69.pdb.gz	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
11	AFDB:Q8VCR8	0.790	0.486	8.453E-32	613	0.327	0.197	Q8VCR8.pdb.gz	MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus OX=10090 GN=Mylk2 PE=1 SV=2
12	PDB:5u6yA	0.714	0.580	2.997E-28	459	0.300	0.242	5u6yA.pdb.gz
13	PDB:2x4fA	0.674	0.854	2.288E-26	289	0.338	0.433	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
14	PDB:8bfsA	0.647	0.858	1.311E-25	274	0.284	0.383	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
15	PDB:3soaA	0.709	0.606	2.725E-25	436	0.284	0.241	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
16	PDB:4rgjA	0.625	0.506	2.215E-22	463	0.270	0.216	4rgjA.pdb.gz
17	PDB:4zhxA	0.621	0.564	1.779E-21	409	0.230	0.208	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:7myjC	0.613	0.492	2.357E-21	465	0.259	0.206	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
19	PDB:6b1uA	0.623	0.526	3.912E-21	442	0.251	0.210	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:5ufuA	0.643	0.645	6.494E-21	369	0.232	0.233	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VDF3	0.0	741	370	0.973	0.973	DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Dapk2 PE=1 SV=1
2	Q9UIK4	0.0	763	370	1.000	1.000	DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=DAPK2 PE=1 SV=1
3	Q80YE7	1.67e-168	509	1442	0.665	0.171	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
4	P53355	2.51e-168	508	1430	0.659	0.171	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6
5	E9QHI3	2.29e-167	477	453	0.611	0.499	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
6	O43293	1.62e-164	469	454	0.608	0.496	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
7	O54784	1.36e-162	464	448	0.586	0.484	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
8	O88764	2.03e-162	464	448	0.586	0.484	DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Dapk3 PE=1 SV=1
9	Q91XS8	1.19e-83	260	371	0.362	0.361	ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus OX=10116 GN=Stk17b PE=1 SV=1
10	Q15746	1.26e-82	276	1914	0.389	0.075	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
11	G1U9Q7	3.45e-82	275	1903	0.373	0.073	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
12	O94768	4.66e-82	256	372	0.359	0.358	ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1
13	Q6PDN3	4.71e-82	275	1941	0.370	0.071	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
14	Q9GM70	4.98e-82	257	397	0.354	0.330	ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus OX=9986 GN=STK17A PE=2 SV=1
15	Q9UEE5	7.95e-82	257	414	0.359	0.321	ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2
16	Q86YV6	4.72e-81	254	388	0.346	0.330	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
17	G4SLH0	1.59e-80	271	18562	0.346	0.007	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
18	Q961U1	2.34e-77	261	1721	0.384	0.083	Q961U1_DROME GH07636p OS=Drosophila melanogaster OX=7227 GN=bt PE=2 SV=1
19	L0MPZ1	3.53e-77	261	8408	0.384	0.017	L0MPZ1_DROME Bent, isoform H OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
20	D1YSG0	3.67e-77	261	8933	0.384	0.016	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13095 FTA2	24	16.1	Kinetochore Sim4 complex subunit FTA2
2	PF02885 Glycos_trans_3N	2.1e+02	13.2	Glycosyl transferase family, helical bundle domain
3	PF06293 Kdo	0.11	23.4	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	3.7e-70	247.9	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	7.8e-32	122.2	Protein tyrosine and serine/threonine kinase
6	PF01163 RIO1	0.04	25.0	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263025	0.857	Mitogen-activated protein kinase 3
2	9606.ENSP00000215832	0.852	Mitogen-activated protein kinase 1
3	9606.ENSP00000355231	0.840	Beclin-1
4	9606.ENSP00000272298	0.829	Calmodulin 2 (phosphorylase kinase, delta)
5	9606.ENSP00000291295	0.829	Calmodulin 3 (phosphorylase kinase, delta)
6	9606.ENSP00000349467	0.829	Calmodulin-1
7	9606.ENSP00000442973	0.807	Death-associated protein kinase 3
8	9606.ENSP00000386135	0.804	Death-associated protein kinase 1
9	9606.ENSP00000311032	0.732	Caspase-3
10	9606.ENSP00000469591	0.724	Zinc finger protein 628
11	9606.ENSP00000334329	0.711	Netrin receptor UNC5B
12	9606.ENSP00000361930	0.710	14-3-3 protein beta/alpha
13	9606.ENSP00000412886	0.702	Calmodulin-binding transcription activator 2
14	9606.ENSP00000206423	0.608	Coiled-coil domain-containing protein 80
15	9606.ENSP00000463092	0.603	Beta-microseminoprotein
16	9606.ENSP00000375919	0.546	Protein Smaug homolog 1
17	9606.ENSP00000377941	0.536	Alpha-actinin-1
18	9606.ENSP00000349359	0.527	SAM and SH3 domain-containing protein 3
19	9606.ENSP00000321951	0.503	Protein lifeguard 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	0.998	ATP binding
GO:0005516	0.994	calmodulin binding
GO:0042802	0.758	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0008152	0.985	metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0016310	0.971	phosphorylation
GO:0044238	0.969	primary metabolic process
GO:0050896	0.966	response to stimulus
GO:0043170	0.965	macromolecule metabolic process
GO:0043412	0.962	macromolecule modification
GO:0048518	0.960	positive regulation of biological process
GO:1901564	0.957	organonitrogen compound metabolic process
GO:0048522	0.949	positive regulation of cellular process
GO:0019538	0.912	protein metabolic process
GO:0002685	0.890	regulation of leukocyte migration
GO:0036211	0.886	protein modification process
GO:0019222	0.869	regulation of metabolic process
GO:0002687	0.868	positive regulation of leukocyte migration
GO:0031323	0.861	regulation of cellular metabolic process
GO:0048583	0.841	regulation of response to stimulus
GO:0051716	0.801	cellular response to stimulus
GO:0006468	0.773	protein phosphorylation
GO:0007154	0.751	cell communication
GO:0071622	0.743	regulation of granulocyte chemotaxis
GO:1902622	0.739	regulation of neutrophil migration
GO:0050900	0.736	leukocyte migration
GO:0097529	0.732	myeloid leukocyte migration
GO:0023052	0.715	signaling
GO:1902624	0.704	positive regulation of neutrophil migration
GO:0097530	0.702	granulocyte migration
GO:1990266	0.689	neutrophil migration
GO:0010941	0.672	regulation of cell death
GO:0010646	0.665	regulation of cell communication
GO:0009966	0.659	regulation of signal transduction
GO:0042981	0.646	regulation of apoptotic process
GO:0007165	0.553	signal transduction
GO:0060255	0.479	regulation of macromolecule metabolic process
GO:0008219	0.461	cell death
GO:0046777	0.429	protein autophosphorylation
GO:1902531	0.427	regulation of intracellular signal transduction
GO:0048584	0.422	positive regulation of response to stimulus
GO:0048519	0.404	negative regulation of biological process
GO:0080090	0.400	regulation of primary metabolic process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0048523	0.367	negative regulation of cellular process
GO:0050921	0.344	positive regulation of chemotaxis
GO:0009893	0.337	positive regulation of metabolic process
GO:2001233	0.337	regulation of apoptotic signaling pathway
GO:0002690	0.330	positive regulation of leukocyte chemotaxis
GO:0031325	0.323	positive regulation of cellular metabolic process
GO:0006915	0.317	apoptotic process
GO:2001242	0.305	regulation of intrinsic apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.991	Golgi apparatus
GO:0005829	0.358	cytosol
GO:0005634	0.338	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]