StarFunc result for job id Q9UIQ6

User Input

>input (1025 residues)
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97629	0.858	0.858	0.000	1025	0.875	0.875	P97629.pdb.gz	LCAP_RAT Leucyl-cystinyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Lnpep PE=1 SV=1
2	AFDB:Q9UIQ6	1.000	1.000	0.000	1025	1.000	1.000	Q9UIQ6.pdb.gz	LCAP_HUMAN Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP PE=1 SV=3
3	AFDB:Q9NZ08	0.836	0.910	4.957E-93	941	0.407	0.443	Q9NZ08.pdb.gz	ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3
4	AFDB:Q9EQH2	0.840	0.925	2.096E-92	930	0.409	0.451	Q9EQH2.pdb.gz	ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus OX=10090 GN=Erap1 PE=1 SV=2
5	AFDB:Q6P179	0.842	0.898	1.193E-91	960	0.398	0.425	Q6P179.pdb.gz	ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens OX=9606 GN=ERAP2 PE=1 SV=2
6	PDB:6rqxA	0.821	0.975	2.016E-89	862	0.402	0.478	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
7	PDB:7pfsA	0.830	0.927	4.938E-86	916	0.388	0.434	7pfsA.pdb.gz	Inhibitor-Dependent Usage of the S1' Specificity Pocket of ER Aminopeptidase 2.
8	PDB:7nupD	0.830	0.961	6.104E-86	884	0.389	0.451	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
9	PDB:5k1vB	0.801	0.964	5.141E-79	849	0.382	0.462	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
10	PDB:3mdjC	0.658	0.807	4.007E-76	819	0.380	0.475	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
11	AFDB:Q9VFX0	0.792	0.816	9.543E-74	994	0.308	0.318	Q9VFX0.pdb.gz	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
12	AFDB:Q10836	0.814	0.814	1.587E-73	1025	0.290	0.290	Q10836.pdb.gz	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
13	AFDB:P50123	0.809	0.876	1.812E-70	945	0.286	0.310	P50123.pdb.gz	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
14	AFDB:B0BCY7	0.814	0.870	7.346E-70	957	0.288	0.308	B0BCY7.pdb.gz	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
15	AFDB:P16406	0.811	0.878	7.664E-70	945	0.286	0.310	P16406.pdb.gz	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1
16	PDB:4kx7A	0.803	0.938	1.516E-66	875	0.280	0.328	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
17	PDB:5lhdC	0.772	0.870	1.828E-64	905	0.286	0.324	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
18	PDB:4wz9B	0.733	0.841	1.020E-58	887	0.228	0.264	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
19	PDB:4xo4A	0.663	0.771	5.945E-36	870	0.157	0.185	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine
20	PDB:3b7rL	0.407	0.658	1.318E-24	610	0.130	0.218	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97629	0.0	1824	1025	0.875	0.875	LCAP_RAT Leucyl-cystinyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Lnpep PE=1 SV=1
2	Q6P179	0.0	772	960	0.391	0.418	ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens OX=9606 GN=ERAP2 PE=1 SV=2
3	Q8C129	0.0	1838	1025	0.878	0.878	LCAP_MOUSE Leucyl-cystinyl aminopeptidase OS=Mus musculus OX=10090 GN=Lnpep PE=1 SV=1
4	Q9EQH2	0.0	798	930	0.408	0.449	ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus OX=10090 GN=Erap1 PE=1 SV=2
5	Q9JJ22	0.0	820	930	0.405	0.446	ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Erap1 PE=2 SV=2
6	Q9NZ08	0.0	823	941	0.408	0.444	ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3
7	Q9UIQ6	0.0	2132	1025	1.000	1.000	LCAP_HUMAN Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP PE=1 SV=3
8	Q9VFX0	1.44e-162	506	994	0.301	0.311	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
9	P15541	6.66e-162	504	966	0.315	0.334	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
10	P97449	6.02e-161	501	966	0.300	0.319	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
11	P15684	2.66e-156	489	965	0.300	0.319	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
12	P16406	3.26e-153	480	945	0.296	0.321	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1
13	P50123	1.04e-152	479	945	0.294	0.319	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
14	Q59E93	3.76e-152	479	977	0.301	0.316	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
15	P15144	5.41e-152	478	967	0.301	0.320	AMPN_HUMAN Aminopeptidase N OS=Homo sapiens OX=9606 GN=ANPEP PE=1 SV=4
16	B0BCY9	2.41e-149	471	957	0.287	0.307	B0BCY9_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
17	B0BCZ2	1.33e-147	466	957	0.288	0.308	B0BCZ2_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
18	B0BCZ1	1.96e-147	466	957	0.288	0.308	B0BCZ1_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
19	B0BCZ5	3.32e-147	465	957	0.287	0.307	B0BCZ5_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
20	B0BCY8	4.96e-147	464	957	0.287	0.307	B0BCY8_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12455 Dynactin	4.7e+02	11.4	Dynein associated protein
2	PF11838 ERAP1_C	1.9e-61	219.9	ERAP1-like C-terminal domain
3	PF01433 Peptidase_M1	8.9e-80	278.9	Peptidase family M1 domain
4	PF17900 Peptidase_M1_N	9.5e-56	200.4	Peptidase M1 N-terminal domain
5	PF13449 Phytase-like	4.4e+02	12.2	Esterase-like activity of phytase
6	PF18165 pP_pnuc_1	87	14.2	Predicted pPIWI-associating nuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231368

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366863	0.991	TBC1 domain family member 4
2	9606.ENSP00000311579	0.988	Tankyrase-1
3	9606.ENSP00000320935	0.982	Solute carrier family 2, facilitated glucose transporter member 4
4	9606.ENSP00000264710	0.966	Ras-related protein Rab-10
5	9606.ENSP00000360689	0.965	Tankyrase-2
6	9606.ENSP00000362946	0.960	Ras-related protein Rab-14
7	9606.ENSP00000300935	0.944	Ras-related protein Rab-8A
8	9606.ENSP00000328551	0.942	Ras-related protein Rab-28
9	9606.ENSP00000314214	0.936	Vesicle-associated membrane protein 2
10	9606.ENSP00000317714	0.936	Syntaxin-4
11	9606.ENSP00000375892	0.928	RAC-beta serine/threonine-protein kinase
12	9606.ENSP00000451828	0.926	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000357564	0.924	Ras-related protein Rab-13
14	9606.ENSP00000306330	0.909	14-3-3 protein gamma
15	9606.ENSP00000361930	0.909	14-3-3 protein beta/alpha
16	9606.ENSP00000264335	0.908	14-3-3 protein epsilon
17	9606.ENSP00000379287	0.908	14-3-3 protein zeta/delta
18	9606.ENSP00000238738	0.907	Rho-related GTP-binding protein RhoQ
19	9606.ENSP00000248975	0.907	14-3-3 protein eta
20	9606.ENSP00000371267	0.907	14-3-3 protein theta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004177	0.999	aminopeptidase activity
GO:0005488	0.998	binding
GO:0005515	0.994	protein binding
GO:0008237	0.927	metallopeptidase activity
GO:0043167	0.792	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0008152	0.975	metabolic process
GO:0071704	0.958	organic substance metabolic process
GO:0065007	0.949	biological regulation
GO:0006807	0.938	nitrogen compound metabolic process
GO:1901564	0.893	organonitrogen compound metabolic process
GO:0050789	0.868	regulation of biological process
GO:0044238	0.843	primary metabolic process
GO:0050794	0.822	regulation of cellular process
GO:0043170	0.684	macromolecule metabolic process
GO:0032501	0.630	multicellular organismal process
GO:0019538	0.549	protein metabolic process
GO:0050896	0.545	response to stimulus
GO:0051716	0.376	cellular response to stimulus
GO:0019222	0.331	regulation of metabolic process
GO:0044237	0.327	cellular metabolic process
GO:0007154	0.312	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0012505	0.996	endomembrane system
GO:0071944	0.988	cell periphery
GO:0031974	0.967	membrane-enclosed lumen
GO:0031410	0.964	cytoplasmic vesicle
GO:0043233	0.962	organelle lumen
GO:0005886	0.952	plasma membrane
GO:0070013	0.934	intracellular organelle lumen
GO:0031090	0.902	organelle membrane
GO:0098588	0.864	bounding membrane of organelle
GO:0012506	0.805	vesicle membrane
GO:0030659	0.741	cytoplasmic vesicle membrane
GO:0005829	0.737	cytosol
GO:0005768	0.681	endosome
GO:0005576	0.605	extracellular region
GO:0005773	0.548	vacuole
GO:0000323	0.487	lytic vacuole
GO:0048471	0.464	perinuclear region of cytoplasm
GO:0005764	0.441	lysosome
GO:0070062	0.418	extracellular exosome
GO:0098852	0.330	lytic vacuole membrane
GO:0005765	0.320	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.11.-	0.999	Aminopeptidases.

[back to server]