StarFunc result for job id Q9UIS9

User Input

>input (605 residues)
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLT
LFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADT
DTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECA
ACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHC
PICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEP
TEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKP
KFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPT
LKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEAL
LQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQE
PPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP
GARKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIS9	1.000	1.000	2.776E-102	605	1.000	1.000	Q9UIS9.pdb.gz	MBD1_HUMAN Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2
2	AFDB:Q9Z2E2	0.455	0.436	7.391E-73	636	0.706	0.671	Q9Z2E2.pdb.gz	MBD1_MOUSE Methyl-CpG-binding domain protein 1 OS=Mus musculus OX=10090 GN=Mbd1 PE=1 SV=2
3	AFDB:Q66HB8	0.173	0.193	5.039E-44	533	0.531	0.602	Q66HB8.pdb.gz	Q66HB8_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=2 SV=1
4	PDB:7ao8C	0.102	0.923	5.324E-8	64	0.061	0.578	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
5	AFDB:Q6ZPZ3	0.065	0.034	1.175E-2	1304	0.162	0.075	Q6ZPZ3.pdb.gz	ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zc3h4 PE=1 SV=2
6	AFDB:Q05812	0.057	0.051	2.322E-2	728	0.107	0.089	Q05812.pdb.gz	MSC3_YEAST Meiotic sister-chromatid recombination protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSC3 PE=1 SV=1
7	AFDB:Q9V8P9	0.058	0.037	8.011E-2	1038	0.147	0.086	Q9V8P9.pdb.gz	TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster OX=7227 GN=Topors PE=1 SV=1
8	AFDB:D4A5D3	0.053	0.036	1.092E-1	1059	0.140	0.080	D4A5D3.pdb.gz	D4A5D3_RAT BUB1 mitotic checkpoint serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bub1 PE=4 SV=1
9	AFDB:Q24248	0.060	0.054	2.028E-1	717	0.152	0.128	Q24248.pdb.gz	ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster OX=7227 GN=ara PE=1 SV=2
10	AFDB:M9PBN6	0.064	0.044	2.296E-1	968	0.126	0.079	M9PBN6.pdb.gz	M9PBN6_DROME Ensconsin, isoform J OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
11	AFDB:P39969	0.057	0.038	2.599E-1	1040	0.165	0.096	P39969.pdb.gz	BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI2 PE=1 SV=1
12	PDB:1qe6D	0.044	0.212	5.576E-1	72	0.010	0.083	1qe6D.pdb.gz
13	PDB:1f9rA	0.043	0.258	6.311E-1	65	0.010	0.092	1f9rA.pdb.gz
14	PDB:2mgsA	0.046	0.275	9.152E-1	71	0.008	0.070	2mgsA.pdb.gz
15	PDB:1nr4E	0.046	0.247	1.036	69	0.013	0.116	1nr4E.pdb.gz
16	PDB:6nt7A	0.051	0.091	1.247	294	0.015	0.031	6nt7A.pdb.gz	Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP.
17	PDB:5yzgY	0.059	0.139	1.412	204	0.013	0.039	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:1g2sA	0.049	0.268	1.598	71	0.013	0.113	1g2sA.pdb.gz
19	PDB:7lbmr	0.053	0.033	1.924	1034	0.012	0.007	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
20	PDB:1esrA	0.038	0.210	2.047	76	0.008	0.066	1esrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMU8	0.0	616	558	0.583	0.633	A0A8I5ZMU8_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
2	A0A8I6A3W5	0.0	788	621	0.696	0.678	A0A8I6A3W5_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
3	A0A8I6AS94	0.0	768	614	0.679	0.669	A0A8I6AS94_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
4	A0A8I6GMJ2	0.0	605	601	0.585	0.589	A0A8I6GMJ2_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
5	Q9UIS9	0.0	1217	605	1.000	1.000	MBD1_HUMAN Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2
6	Q9Z2E2	0.0	774	636	0.706	0.671	MBD1_MOUSE Methyl-CpG-binding domain protein 1 OS=Mus musculus OX=10090 GN=Mbd1 PE=1 SV=2
7	Q66HB8	1.42e-180	523	533	0.527	0.598	Q66HB8_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=2 SV=1
8	A0A8I6AFM4	1.68e-18	87.4	246	0.063	0.154	A0A8I6AFM4_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=1
9	Q9Z2E1	3.66e-18	89.4	414	0.063	0.092	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
10	B0BNM2	3.74e-18	89.4	412	0.063	0.092	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
11	D4A986	3.95e-18	89.4	412	0.063	0.092	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
12	X6RBL6	7.24e-18	85.5	241	0.061	0.154	X6RBL6_HUMAN Methyl-CpG binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
13	Q9UBB5	1.16e-17	87.8	411	0.061	0.090	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
14	O95983	1.23e-13	73.9	291	0.053	0.110	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
15	Q9Z2D8	1.26e-13	73.9	285	0.053	0.112	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
16	Q6PGZ4	3.24e-10	65.5	570	0.055	0.058	Q6PGZ4_DANRE CXXC-type zinc finger protein 1 OS=Danio rerio OX=7955 GN=cxxc1l PE=2 SV=1
17	K7EQZ1	3.63e-10	65.1	604	0.071	0.071	K7EQZ1_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=9
18	A0A669KB29	3.74e-10	65.1	647	0.071	0.066	A0A669KB29_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=1
19	K7EQ21	1.44e-09	63.2	613	0.060	0.059	K7EQ21_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=1
20	F7EKZ5	1.48e-09	63.2	631	0.060	0.057	F7EKZ5_RAT CXXC-type zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Cxxc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	6.6e-13	59.5	Methyl-CpG binding domain
2	PF02008 zf-CXXC	4.9e-29	111.4	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000014090

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004763	0.783	Activating transcription factor 7 interacting protein
2	60711.ENSCSAP00000014051	0.749	Histone-lysine N-methyltransferase
3	60711.ENSCSAP00000009610	0.714	Protein inhibitor of activated STAT, 1
4	60711.ENSCSAP00000006785	0.694	Chromatin assembly factor 1, subunit A (p150)
5	60711.ENSCSAP00000016260	0.679	Protein inhibitor of activated STAT, 3
6	60711.ENSCSAP00000014013	0.543	Protein inhibitor of activated STAT, 2
7	60711.ENSCSAP00000005288	0.530	Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein.
8	60711.ENSCSAP00000001750	0.528	Chromobox homolog 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0010385	1.000	double-stranded methylated DNA binding
GO:0008327	1.000	methyl-CpG binding
GO:0005515	0.999	protein binding
GO:0008270	0.996	zinc ion binding
GO:0003682	0.932	chromatin binding
GO:0045322	0.610	unmethylated CpG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0044238	0.961	primary metabolic process
GO:0050789	0.959	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0071704	0.947	organic substance metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0006807	0.945	nitrogen compound metabolic process
GO:0043170	0.918	macromolecule metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0051171	0.870	regulation of nitrogen compound metabolic process
GO:0048519	0.845	negative regulation of biological process
GO:0044237	0.841	cellular metabolic process
GO:0031323	0.830	regulation of cellular metabolic process
GO:0010468	0.793	regulation of gene expression
GO:0034641	0.727	cellular nitrogen compound metabolic process
GO:0006725	0.718	cellular aromatic compound metabolic process
GO:0046483	0.717	heterocycle metabolic process
GO:0048523	0.717	negative regulation of cellular process
GO:0090304	0.714	nucleic acid metabolic process
GO:0019219	0.698	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.628	response to stimulus
GO:0010605	0.628	negative regulation of macromolecule metabolic process
GO:0006351	0.569	DNA-templated transcription
GO:0032501	0.493	multicellular organismal process
GO:0006366	0.485	transcription by RNA polymerase II
GO:0044030	0.475	regulation of DNA methylation
GO:0032502	0.441	developmental process
GO:0007275	0.432	multicellular organism development
GO:0048731	0.417	system development
GO:0032355	0.391	response to estradiol
GO:0072359	0.390	circulatory system development
GO:0007507	0.378	heart development
GO:0014013	0.376	regulation of gliogenesis
GO:0007568	0.374	aging
GO:0031326	0.356	regulation of cellular biosynthetic process
GO:0010556	0.353	regulation of macromolecule biosynthetic process
GO:0045596	0.350	negative regulation of cell differentiation
GO:0010721	0.329	negative regulation of cell development
GO:0042220	0.314	response to cocaine
GO:0014014	0.312	negative regulation of gliogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.935	intracellular non-membrane-bounded organelle
GO:0005737	0.893	cytoplasm
GO:0000785	0.815	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]