StarFunc result for job id Q9UIV8

User Input

>input (391 residues)
MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE
KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY
LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM
VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN
DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL
AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG
HENVHCNHPFLFFIRHNESNSILFFGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MQW3	0.928	0.907	1.652E-79	400	1.000	0.978	A0A0A0MQW3.pdb.gz	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
2	AFDB:P29508	0.932	0.935	8.367E-59	390	0.583	0.585	P29508.pdb.gz	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
3	AFDB:A2RSF9	0.913	0.925	5.452E-55	386	0.483	0.490	A2RSF9.pdb.gz	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
4	AFDB:Q6UKZ2	0.885	0.894	1.117E-54	387	0.517	0.522	Q6UKZ2.pdb.gz	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
5	PDB:2zv6B	0.878	0.924	1.733E-53	371	0.565	0.596	2zv6B.pdb.gz
6	AFDB:P48595	0.899	0.886	4.947E-52	397	0.448	0.441	P48595.pdb.gz	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
7	AFDB:P30740	0.895	0.923	1.490E-50	379	0.468	0.483	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
8	AFDB:Q96P63	0.916	0.886	6.636E-50	405	0.437	0.422	Q96P63.pdb.gz	SPB12_HUMAN Serpin B12 OS=Homo sapiens OX=9606 GN=SERPINB12 PE=1 SV=1
9	AFDB:Q8VHP7	0.895	0.916	1.136E-49	382	0.430	0.440	Q8VHP7.pdb.gz	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
10	AFDB:Q9D154	0.896	0.923	1.359E-49	379	0.442	0.456	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
11	AFDB:O73790	0.905	0.865	1.626E-49	410	0.422	0.402	O73790.pdb.gz	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
12	PDB:4ga7A	0.881	0.932	1.232E-48	369	0.448	0.474	4ga7A.pdb.gz
13	PDB:2h4rA	0.860	0.904	9.604E-45	371	0.404	0.426	2h4rA.pdb.gz
14	PDB:1xqgA	0.855	0.882	1.904E-43	378	0.332	0.344	1xqgA.pdb.gz
15	PDB:2arqA	0.816	0.882	1.137E-40	360	0.381	0.414	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
16	PDB:2ol2A	0.836	0.905	1.444E-40	360	0.284	0.308	2ol2A.pdb.gz
17	PDB:1jmoA	0.833	0.767	2.394E-39	427	0.279	0.255	1jmoA.pdb.gz
18	PDB:1hp7A	0.838	0.870	7.449E-39	376	0.289	0.301	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
19	PDB:4x30A	0.832	0.872	8.127E-38	372	0.281	0.296	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution
20	PDB:1yxaA	0.837	0.878	1.235E-37	372	0.294	0.309	1yxaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQW3	0.0	798	400	1.000	0.978	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
2	Q9UIV8	0.0	806	391	1.000	1.000	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
3	P48594	7.64e-154	441	390	0.583	0.585	SPB4_HUMAN Serpin B4 OS=Homo sapiens OX=9606 GN=SERPINB4 PE=1 SV=2
4	P29508	2.28e-152	437	390	0.565	0.567	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
5	Q9D1Q5	8.52e-144	415	387	0.519	0.525	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
6	Q8BHL1	6.62e-142	410	387	0.522	0.527	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
7	Q6UKZ2	1.42e-141	410	387	0.522	0.527	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
8	A2RSF9	8.95e-131	382	386	0.483	0.490	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
9	Q6UKZ1	2.08e-128	376	386	0.478	0.484	Q6UKZ1_MOUSE Serpinb3c OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
10	Q9D1E7	8.75e-128	374	386	0.478	0.484	Q9D1E7_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
11	P48595	4.90e-117	347	397	0.458	0.451	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
12	Q9D154	3.63e-107	322	379	0.440	0.454	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
13	P30740	2.27e-106	320	379	0.460	0.475	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
14	V9HWH1	2.27e-106	320	379	0.460	0.475	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
15	A0A024QZT4	8.84e-106	318	376	0.425	0.441	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
16	P50453	8.84e-106	318	376	0.425	0.441	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
17	P01014	2.10e-103	312	388	0.417	0.420	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
18	R9TNA6	7.05e-103	311	402	0.409	0.398	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
19	Q8K3K4	4.06e-102	310	397	0.437	0.431	SPB10_RAT Serpin B10 OS=Rattus norvegicus OX=10116 GN=Serpinb10 PE=2 SV=1
20	O73790	4.52e-101	307	410	0.425	0.405	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03257 Adhesin_P1_C	42	16.0	Mycoplasma adhesin P1, C-terminal
2	PF10437 Lip_prot_lig_C	2.4e+02	13.1	Bacterial lipoate protein ligase C-terminus
3	PF00079 Serpin	6.7e-125	428.9	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300305	0.900	Runt-related transcription factor 1
2	9606.ENSP00000415151	0.900	Core-binding factor subunit beta
3	9606.ENSP00000271651	0.872	Cathepsin K
4	9606.ENSP00000216336	0.865	Cathepsin G
5	9606.ENSP00000345344	0.819	Cathepsin L1
6	9606.ENSP00000362778	0.732	Peptidase inhibitor 16
7	9606.ENSP00000257189	0.699	Desmoglein-3
8	9606.ENSP00000445052	0.682	Cathepsin L2
9	9606.ENSP00000260113	0.681	Peptidase inhibitor 15
10	9606.ENSP00000262340	0.666	Retinoid isomerohydrolase
11	9606.ENSP00000359596	0.560	Calcium-activated chloride channel regulator 2
12	9606.ENSP00000252252	0.530	Keratin, type II cytoskeletal 6B
13	9606.ENSP00000369317	0.525	Keratin, type II cytoskeletal 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0002020	0.998	protease binding
GO:0004869	0.519	cysteine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.965	regulation of biological process
GO:0019222	0.942	regulation of metabolic process
GO:0050896	0.906	response to stimulus
GO:0060255	0.902	regulation of macromolecule metabolic process
GO:0009987	0.865	cellular process
GO:0048519	0.815	negative regulation of biological process
GO:0050794	0.805	regulation of cellular process
GO:0080090	0.767	regulation of primary metabolic process
GO:1904035	0.715	regulation of epithelial cell apoptotic process
GO:0051346	0.713	negative regulation of hydrolase activity
GO:0051171	0.681	regulation of nitrogen compound metabolic process
GO:0052547	0.673	regulation of peptidase activity
GO:0010466	0.657	negative regulation of peptidase activity
GO:0048523	0.643	negative regulation of cellular process
GO:0060548	0.561	negative regulation of cell death
GO:0043066	0.553	negative regulation of apoptotic process
GO:0009411	0.459	response to UV
GO:0052548	0.417	regulation of endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031974	0.997	membrane-enclosed lumen
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.991	nucleus
GO:0005829	0.985	cytosol
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.981	nucleoplasm
GO:0005576	0.968	extracellular region
GO:0070062	0.914	extracellular exosome
GO:0016020	0.838	membrane
GO:0005764	0.775	lysosome
GO:0016604	0.768	nuclear body
GO:0005775	0.739	vacuolar lumen
GO:0012505	0.728	endomembrane system
GO:0016607	0.706	nuclear speck
GO:0071944	0.644	cell periphery
GO:0005886	0.374	plasma membrane
GO:0031410	0.325	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]