StarFunc result for job id Q9UIW0

User Input

>input (290 residues)
MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRES
GADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEME
FQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATS
NILRLLEQGRLLSVPRAPSLLALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASASPP
LPPPLPAVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVGSASSCKKANT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIW0	1.000	1.000	2.518E-41	290	1.000	1.000	Q9UIW0.pdb.gz	VAX2_HUMAN Ventral anterior homeobox 2 OS=Homo sapiens OX=9606 GN=VAX2 PE=1 SV=1
2	AFDB:Q9WTP9	0.537	0.534	1.701E-35	292	0.879	0.873	Q9WTP9.pdb.gz	VAX2_MOUSE Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1
3	AFDB:Q9PU20	0.372	0.359	3.841E-24	302	0.603	0.579	Q9PU20.pdb.gz	VAX2A_XENLA Ventral anterior homeobox 2a OS=Xenopus laevis OX=8355 GN=vax2-a PE=2 SV=1
4	AFDB:Q801E1	0.405	0.385	3.166E-23	307	0.586	0.554	Q801E1.pdb.gz	VAX2_DANRE Ventral anterior homeobox 2 OS=Danio rerio OX=7955 GN=vax2 PE=2 SV=1
5	AFDB:Q801E0	0.361	0.333	2.148E-20	317	0.486	0.445	Q801E0.pdb.gz	VAX1_DANRE Ventral anterior homeobox 1 OS=Danio rerio OX=7955 GN=vax1 PE=2 SV=1
6	AFDB:Q2NKI2	0.344	0.298	4.625E-20	338	0.476	0.408	Q2NKI2.pdb.gz	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2
7	AFDB:P42580	0.214	0.204	1.739E-7	305	0.259	0.246	P42580.pdb.gz	NKX12_MOUSE NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1
8	AFDB:G3UXB3	0.212	0.158	1.854E-7	402	0.259	0.187	G3UXB3.pdb.gz	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
9	AFDB:Q9DE09	0.261	0.233	1.976E-7	333	0.276	0.240	Q9DE09.pdb.gz	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
10	AFDB:Q9NP08	0.213	0.178	4.256E-7	348	0.286	0.239	Q9NP08.pdb.gz	HMX1_HUMAN Homeobox protein HMX1 OS=Homo sapiens OX=9606 GN=HMX1 PE=2 SV=2
11	PDB:4egcA	0.174	0.094	2.186E-2	539	0.055	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.155	0.552	1.228E-1	73	0.059	0.233	2hi3A.pdb.gz
13	PDB:8escP	0.103	0.103	3.004E-1	272	0.069	0.074	8escP.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
14	PDB:7fbyA	0.133	0.232	4.408E-1	153	0.038	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:7l08a	0.091	0.163	5.009E-1	108	0.045	0.120	7l08a.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
16	PDB:5ds9B	0.104	0.272	6.469E-1	98	0.031	0.092	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
17	PDB:6i9ra	0.074	0.219	6.469E-1	83	0.045	0.157	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
18	PDB:5nr5A	0.134	0.314	7.836E-1	113	0.031	0.080	5nr5A.pdb.gz
19	PDB:7dcoL	0.146	0.101	8.905E-1	435	0.069	0.046	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:6v7wE	0.097	0.117	1.079	234	0.048	0.060	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UIW0	0.0	577	290	1.000	1.000	VAX2_HUMAN Ventral anterior homeobox 2 OS=Homo sapiens OX=9606 GN=VAX2 PE=1 SV=1
2	Q9WTP9	4.51e-156	439	292	0.879	0.873	VAX2_MOUSE Ventral anterior homeobox 2 OS=Mus musculus OX=10090 GN=Vax2 PE=1 SV=1
3	Q9PU20	6.18e-102	301	302	0.617	0.593	VAX2A_XENLA Ventral anterior homeobox 2a OS=Xenopus laevis OX=8355 GN=vax2-a PE=2 SV=1
4	Q801E1	3.60e-83	254	307	0.607	0.573	VAX2_DANRE Ventral anterior homeobox 2 OS=Danio rerio OX=7955 GN=vax2 PE=2 SV=1
5	Q801E0	3.97e-72	226	317	0.503	0.461	VAX1_DANRE Ventral anterior homeobox 1 OS=Danio rerio OX=7955 GN=vax1 PE=2 SV=1
6	Q2NKI2	1.40e-65	210	338	0.397	0.340	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2
7	P18488	4.84e-20	91.7	497	0.141	0.082	EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2
8	Q8MZ02	8.15e-20	90.5	378	0.200	0.153	Q8MZ02_DROME Lateral muscles scarcer, isoform B OS=Drosophila melanogaster OX=7227 GN=lms PE=2 SV=1
9	Q568U8	6.00e-19	85.9	247	0.152	0.178	Q568U8_DANRE Empty spiracles homeobox 2 OS=Danio rerio OX=7955 GN=wu:fk69b03 PE=2 SV=1
10	Q04743	1.07e-18	85.5	252	0.152	0.175	EMX2_HUMAN Homeobox protein EMX2 OS=Homo sapiens OX=9606 GN=EMX2 PE=1 SV=2
11	Q04744	1.09e-18	85.5	253	0.152	0.174	EMX2_MOUSE Homeobox protein EMX2 OS=Mus musculus OX=10090 GN=Emx2 PE=1 SV=3
12	G5EGF2	3.47e-18	80.1	106	0.131	0.358	G5EGF2_CAEEL COG-1B OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
13	Q91770	4.26e-18	83.2	233	0.155	0.193	NOT2_XENLA Homeobox protein not2 OS=Xenopus laevis OX=8355 GN=not2 PE=2 SV=1
14	Q804S6	1.52e-17	81.6	231	0.131	0.165	EMX1_DANRE Homeobox protein EMX1 OS=Danio rerio OX=7955 GN=emx1 PE=2 SV=1
15	Q04741	1.96e-17	82.4	290	0.131	0.131	EMX1_HUMAN Homeobox protein EMX1 OS=Homo sapiens OX=9606 GN=EMX1 PE=1 SV=3
16	G5EGE2	2.15e-17	82.0	256	0.131	0.148	G5EGE2_CAEEL COG-1A OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
17	Q04742	2.31e-17	81.6	257	0.131	0.148	EMX1_MOUSE Homeobox protein EMX1 OS=Mus musculus OX=10090 GN=Emx1 PE=1 SV=2
18	Q06615	2.80e-17	81.3	236	0.131	0.161	NOTO_XENLA Homeobox protein notochord OS=Xenopus laevis OX=8355 GN=noto PE=2 SV=1
19	G5ECT8	3.92e-17	80.1	209	0.128	0.177	HM02_CAEEL Homeobox protein ceh-2 OS=Caenorhabditis elegans OX=6239 GN=ceh-2 PE=1 SV=1
20	Q90263	1.50e-16	79.0	233	0.128	0.159	Q90263_DANRE Empty spiracles homeobox 3 OS=Danio rerio OX=7955 GN=emx1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	8.4	17.7	Homeobox KN domain
2	PF00046 Homeodomain	7.6e-19	78.6	Homeodomain
3	PF11569 Homez	5.1e+02	11.7	Homeodomain leucine-zipper encoding, Homez
4	PF13518 HTH_28	26	16.4	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234392

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260653	0.731	Homeobox protein SIX3
2	9606.ENSP00000309913	0.659	T-box transcription factor TBX5
3	9606.ENSP00000359319	0.658	Paired box protein Pax-2
4	9606.ENSP00000362942	0.607	Phosphatase and actin regulator 4
5	9606.ENSP00000328596	0.591	Homeobox protein SIX6
6	9606.ENSP00000287020	0.575	Growth/differentiation factor 6
7	9606.ENSP00000285949	0.520	Cytochrome P450 26C1
8	9606.ENSP00000240328	0.512	T-box transcription factor TBX2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0005515	0.997	protein binding
GO:0003700	0.982	DNA-binding transcription factor activity
GO:0000981	0.967	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.852	transcription cis-regulatory region binding
GO:0000977	0.811	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.473	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.378	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.313	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.999	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0007275	0.979	multicellular organism development
GO:0050794	0.956	regulation of cellular process
GO:0009987	0.896	cellular process
GO:0048731	0.893	system development
GO:0048513	0.859	animal organ development
GO:0019222	0.834	regulation of metabolic process
GO:0010468	0.824	regulation of gene expression
GO:0006355	0.813	regulation of DNA-templated transcription
GO:0007399	0.653	nervous system development
GO:0048518	0.630	positive regulation of biological process
GO:0048522	0.598	positive regulation of cellular process
GO:0006357	0.566	regulation of transcription by RNA polymerase II
GO:0048523	0.523	negative regulation of cellular process
GO:0009653	0.499	anatomical structure morphogenesis
GO:0010604	0.427	positive regulation of macromolecule metabolic process
GO:0050896	0.376	response to stimulus
GO:0045893	0.371	positive regulation of DNA-templated transcription
GO:0050877	0.326	nervous system process
GO:0009888	0.319	tissue development
GO:0010605	0.309	negative regulation of macromolecule metabolic process
GO:0045934	0.308	negative regulation of nucleobase-containing compound metabolic process
GO:0030154	0.307	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.974	intracellular organelle lumen
GO:0005737	0.967	cytoplasm
GO:0031981	0.954	nuclear lumen
GO:0005654	0.669	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]