StarFunc result for job id Q9UIW2

User Input

>input (1896 residues)
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQT
GEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLL
DYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQ
GQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFP
AFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPI
GCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLF
TLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVT
IEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVA
QEGSPILRDLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSI
CSRRDACERADEPQRFAADLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSF
EDFTESESVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGSFPCHWCKYRHVCTHNVADCAFLEGRVNVSEDCPQILPSTQIYVPVG
VVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVS
DLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLR
HHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGV
RVGKVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVT
PTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQS
PGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPR
IRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLN
STSFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLT
VSETQLLCEAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVI
VAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIP
FLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRS
FSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKM
LTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDY
KTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRPKAADMDLEWRQ
GRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSL
SRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYL
TRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTW
KSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKL
LYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIT
KYKDEILAALEKDEQARRQRLRSKLEQVVDTMALSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.478	0.467	0.000	1945	0.300	0.293	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.759	0.757	0.000	1902	0.632	0.630	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.658	0.659	0.000	1892	0.674	0.675	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.516	0.530	0.000	1842	0.335	0.345	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.465	0.463	0.000	1902	0.341	0.340	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.447	0.389	0.000	2220	0.360	0.307	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.522	0.530	0.000	1864	0.320	0.325	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	0.517	0.532	0.000	1838	0.334	0.344	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.436	0.393	0.000	2135	0.368	0.326	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.377	0.397	0.000	1766	0.249	0.267	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.207	0.482	1.656E-25	747	0.075	0.191	6vxkB.pdb.gz
12	PDB:6qp7A	0.198	0.545	2.473E-19	620	0.054	0.166	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.202	0.585	1.783E-17	588	0.060	0.194	3nvqA.pdb.gz
14	PDB:3nvnA	0.159	0.665	5.797E-11	383	0.028	0.138	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:7sqcO0	0.064	0.093	1.920E-9	1140	0.052	0.087	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5a42A	0.079	0.091	3.185E-8	1597	0.082	0.098	5a42A.pdb.gz
17	PDB:4aq1A	0.053	0.101	2.646E-7	721	0.028	0.074	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
18	PDB:5e7gA	0.065	0.181	2.646E-7	446	0.023	0.099	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:1e07A	0.058	0.121	3.904E-7	642	0.038	0.112	1e07A.pdb.gz
20	PDB:4lnvA	0.070	0.096	3.904E-7	1276	0.064	0.095	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	2471	1902	0.639	0.637	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	3114	1885	0.792	0.796	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	2650	1892	0.671	0.673	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	924	1842	0.342	0.352	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	889	1864	0.330	0.336	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	952	1902	0.347	0.346	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	811	2220	0.256	0.219	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	890	1864	0.330	0.336	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	1361	1928	0.422	0.415	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	939	1838	0.336	0.347	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	831	2135	0.265	0.235	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	2486	1894	0.636	0.636	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	1368	1945	0.425	0.414	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	2564	1871	0.660	0.669	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	3727	1894	0.960	0.961	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	2487	1894	0.637	0.637	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	2569	1872	0.656	0.664	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	1163	1505	0.350	0.441	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	869	1925	0.340	0.335	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	1017	1945	0.352	0.343	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	2.1e-196	664.7	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	8.3e-43	156.6	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	4.4e-16	70.5	Plexin repeat
4	PF01403 Sema	2.8e-21	87.7	Sema domain
5	PF01833 TIG	4.2e-42	153.5	IPT/TIG domain
6	PF18020 TIG_2	5.1e-25	99.2	TIG domain found in plexin
7	PF17960 TIG_plexin	1.8e-19	80.7	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.999	Neuropilin-1
2	9606.ENSP00000265362	0.996	Semaphorin-3A
3	9606.ENSP00000362205	0.996	Triggering receptor expressed on myeloid cells 2
4	9606.ENSP00000308461	0.995	Rho-related GTP-binding protein Rho6
5	9606.ENSP00000262629	0.986	TYRO protein tyrosine kinase-binding protein
6	9606.ENSP00000353582	0.984	Neuropilin-2
7	9606.ENSP00000264042	0.983	FERM, ARHGEF and pleckstrin domain-containing protein 2
8	9606.ENSP00000308576	0.974	Rho-related GTP-binding protein RhoD
9	9606.ENSP00000002829	0.973	Semaphorin-3F
10	9606.ENSP00000246792	0.970	Ras-related protein R-Ras
11	9606.ENSP00000257414	0.967	Semaphorin-6A
12	9606.ENSP00000331504	0.949	Tyrosine-protein kinase Fes/Fps
13	9606.ENSP00000265361	0.947	Semaphorin-3C
14	9606.ENSP00000357909	0.946	Semaphorin-6C
15	9606.ENSP00000389588	0.941	Semaphorin-5B
16	9606.ENSP00000263923	0.928	Vascular endothelial growth factor receptor 2
17	9606.ENSP00000336740	0.920	LIM domain kinase 1
18	9606.ENSP00000304283	0.912	Ras-related C3 botulinum toxin substrate 3
19	9606.ENSP00000324806	0.909	Glycogen synthase kinase-3 beta
20	9606.ENSP00000346671	0.909	Tyrosine-protein kinase Fyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017154	1.000	semaphorin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.991	response to stimulus
GO:0048731	0.987	system development
GO:0050794	0.986	regulation of cellular process
GO:0009653	0.982	anatomical structure morphogenesis
GO:0040012	0.972	regulation of locomotion
GO:0016043	0.960	cellular component organization
GO:0032990	0.948	cell part morphogenesis
GO:0040011	0.941	locomotion
GO:0006935	0.934	chemotaxis
GO:0030154	0.929	cell differentiation
GO:0120039	0.915	plasma membrane bounded cell projection morphogenesis
GO:0048468	0.904	cell development
GO:0048812	0.894	neuron projection morphogenesis
GO:0048513	0.849	animal organ development
GO:0030334	0.832	regulation of cell migration
GO:0051716	0.831	cellular response to stimulus
GO:0023052	0.813	signaling
GO:0007154	0.812	cell communication
GO:0048667	0.796	cell morphogenesis involved in neuron differentiation
GO:0007165	0.790	signal transduction
GO:0007417	0.772	central nervous system development
GO:0021602	0.755	cranial nerve morphogenesis
GO:0021953	0.745	central nervous system neuron differentiation
GO:0021954	0.742	central nervous system neuron development
GO:0007166	0.736	cell surface receptor signaling pathway
GO:0016477	0.717	cell migration
GO:0097485	0.701	neuron projection guidance
GO:0007409	0.670	axonogenesis
GO:0048518	0.652	positive regulation of biological process
GO:0071526	0.651	semaphorin-plexin signaling pathway
GO:0021761	0.615	limbic system development
GO:0007411	0.604	axon guidance
GO:0048646	0.589	anatomical structure formation involved in morphogenesis
GO:0048522	0.581	positive regulation of cellular process
GO:0035295	0.571	tube development
GO:0001764	0.560	neuron migration
GO:0021884	0.544	forebrain neuron development
GO:0001763	0.539	morphogenesis of a branching structure
GO:0048519	0.530	negative regulation of biological process
GO:0050793	0.509	regulation of developmental process
GO:0048583	0.478	regulation of response to stimulus
GO:0051128	0.466	regulation of cellular component organization
GO:0048523	0.457	negative regulation of cellular process
GO:0021536	0.423	diencephalon development
GO:0009888	0.417	tissue development
GO:0048729	0.404	tissue morphogenesis
GO:0051239	0.390	regulation of multicellular organismal process
GO:0120035	0.389	regulation of plasma membrane bounded cell projection organization
GO:0009887	0.369	animal organ morphogenesis
GO:0009790	0.341	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.921	protein-containing complex
GO:0043226	0.811	organelle
GO:0005622	0.795	intracellular anatomical structure
GO:0043227	0.756	membrane-bounded organelle
GO:0043235	0.721	receptor complex
GO:0005737	0.582	cytoplasm
GO:0043231	0.460	intracellular membrane-bounded organelle
GO:0031982	0.407	vesicle
GO:0005576	0.388	extracellular region
GO:0065010	0.384	extracellular membrane-bounded organelle
GO:0002116	0.368	semaphorin receptor complex
GO:0070062	0.340	extracellular exosome
GO:0005829	0.315	cytosol
GO:0031974	0.313	membrane-enclosed lumen
GO:0005634	0.303	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]