StarFunc result for job id Q9UJ37

User Input

>input (374 residues)
MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWT
GKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQ
VIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNG
AVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVML
RSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDL
YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALW
RDLHKAGILQLYQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJ37	1.000	1.000	3.374E-77	374	1.000	1.000	Q9UJ37.pdb.gz	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
2	PDB:6aplC	0.804	0.980	6.252E-56	306	0.818	1.000	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
3	AFDB:Q7T2X4	0.801	0.674	5.190E-39	446	0.388	0.325	Q7T2X4.pdb.gz	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
4	AFDB:Q92183	0.786	0.525	6.926E-38	566	0.369	0.244	Q92183.pdb.gz	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1
5	AFDB:Q9QZ39	0.745	0.536	8.250E-35	526	0.390	0.278	Q9QZ39.pdb.gz	SIA7A_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6galnac1 PE=1 SV=2
6	AFDB:Q9NSC7	0.769	0.487	1.039E-33	600	0.369	0.230	Q9NSC7.pdb.gz	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
7	AFDB:Q11204	0.630	0.668	2.793E-20	350	0.230	0.246	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
8	AFDB:Q11201	0.584	0.638	1.324E-17	340	0.243	0.268	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
9	AFDB:Q02745	0.568	0.615	1.485E-17	343	0.259	0.283	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
10	AFDB:P61131	0.597	0.664	2.801E-16	333	0.201	0.225	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
11	AFDB:P54751	0.581	0.640	3.956E-16	337	0.219	0.243	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
12	PDB:1pswA	0.089	0.096	1.832E-1	331	0.056	0.063	1pswA.pdb.gz
13	PDB:7pzyB	0.124	0.176	2.742E-1	208	0.061	0.111	7pzyB.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:2cf5A	0.091	0.095	2.905E-1	352	0.035	0.037	2cf5A.pdb.gz	Crystal Structures and Catalytic Mechanisms of the Arabidopsis Cinnamyl Alcohol Dehydrogenases Atcad5 and Atcad4
15	PDB:3v2uA	0.107	0.102	3.077E-1	409	0.032	0.029	3v2uA.pdb.gz	The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.
16	PDB:7dbjA	0.113	0.122	3.657E-1	333	0.045	0.051	7dbjA.pdb.gz	Identification of the first highly selective inhibitor of human lactate dehydrogenase B.
17	PDB:1gsoA	0.079	0.072	3.874E-1	419	0.032	0.029	1gsoA.pdb.gz
18	PDB:2f1kA	0.108	0.132	3.874E-1	279	0.024	0.032	2f1kA.pdb.gz	Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction
19	PDB:6tuyA	0.069	0.048	3.874E-1	667	0.053	0.030	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:3jd5B	0.143	0.200	4.103E-1	217	0.080	0.138	3jd5B.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJ37	0.0	772	374	1.000	1.000	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
2	Q7T2X4	1.64e-98	301	446	0.369	0.309	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
3	Q92183	1.48e-76	248	566	0.364	0.240	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1
4	Q9QZ39	6.01e-71	233	526	0.364	0.259	SIA7A_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6galnac1 PE=1 SV=2
5	Q9NSC7	6.08e-69	229	600	0.364	0.227	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
6	Q16842	7.59e-22	97.4	350	0.267	0.286	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
7	Q11204	5.77e-21	94.7	350	0.203	0.217	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
8	Q11205	6.18e-21	94.7	350	0.193	0.206	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
9	Q02745	1.04e-20	94.0	343	0.163	0.178	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
10	Q11201	6.04e-20	92.0	340	0.182	0.200	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
11	P54751	8.32e-19	88.6	337	0.152	0.169	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
12	P97325	3.00e-18	87.4	374	0.201	0.201	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
13	Q11203	1.88e-17	85.1	375	0.201	0.200	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
14	Q02734	1.16e-16	82.8	374	0.195	0.195	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
15	B0CN48	2.36e-15	79.0	374	0.195	0.195	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
16	O15466	3.07e-13	72.4	376	0.211	0.210	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
17	Q11206	3.27e-13	72.0	333	0.182	0.204	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
18	Q9UNP4	6.41e-13	71.6	418	0.195	0.175	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
19	Q6ZXA0	8.36e-13	71.2	359	0.193	0.201	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
20	Q91Y74	1.66e-12	70.1	333	0.171	0.192	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2.2e-65	232.5	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484824	0.926	Mucin-1
2	9606.ENSP00000436812	0.914	Mucin-5B
3	9606.ENSP00000381008	0.910	Mucin-16
4	9606.ENSP00000406861	0.909	Mucin-6
5	9606.ENSP00000417498	0.906	Mucin-4
6	9606.ENSP00000414350	0.902	Mucin-20
7	9606.ENSP00000485659	0.902	Mucin-5AC
8	9606.ENSP00000416753	0.901	Mucin-15
9	9606.ENSP00000302716	0.900	Mucin-17
10	9606.ENSP00000311364	0.900	Mucin-like protein 1
11	9606.ENSP00000365473	0.900	Mucin-21
12	9606.ENSP00000368771	0.900	Mucin-3A
13	9606.ENSP00000407422	0.900	Mucin-7
14	9606.ENSP00000441929	0.900	Mucin-12
15	9606.ENSP00000485028	0.900	Mucin-13
16	9606.ENSP00000217182	0.829	Elongation factor 1-alpha 2
17	9606.ENSP00000393887	0.819	Alpha-2-HS-glycoprotein
18	9606.ENSP00000389176	0.739	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
19	9606.ENSP00000304364	0.715	C1GALT1-specific chaperone 1
20	9606.ENSP00000415454	0.609	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0001665	0.865	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
GO:0005515	0.694	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:1901566	0.993	organonitrogen compound biosynthetic process
GO:0044249	0.992	cellular biosynthetic process
GO:1901137	0.991	carbohydrate derivative biosynthetic process
GO:0043170	0.979	macromolecule metabolic process
GO:0009100	0.965	glycoprotein metabolic process
GO:0006486	0.960	protein glycosylation
GO:0006493	0.923	protein O-linked glycosylation
GO:0016032	0.764	viral process
GO:0019080	0.749	viral gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005615	0.603	extracellular space
GO:0070013	0.427	intracellular organelle lumen
GO:0070062	0.318	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.865	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.865	Transferred entry: 2.4.3.3.

[back to server]