StarFunc result for job id Q9UJ55

User Input

>input (1249 residues)
MSQLSKNLGDSSPPAEAPKPPVYSRPTVLMRAPPASSRAPPVPWDPPPIDLQASLAAWQA
PQPAWEAPQGQLPAPVVPMTQPPALGGPIVPAPPLGGPMGKPPTPGVLMVHPPPPGAPMA
QPPTPGVLMVHPSAPGAPMAHPPPPGTPMSHPPPPGTPMAHPPPPGTPMAHPPPPGTPMV
HPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAQPPAPGVLMA
QPLTPGVLMVQPAAPGAPMVQPPPAAMMTQPQPSGAPMAKPPGPGVLMIHPPGARAPMTQ
PPASGAPMAQPAAPPAQPMAPPAQPMASWAPQAQPLILQIQSQVIRAPPQVPQGPQAPPA
QLATPPGWQATSPGWQATQQGWQATPLTWQTTQVTWQAPAVTWQVPPPMRQGPPPIRPGP
PPIRPGPPPVRQAPPLIRQAPPVIRQAPPVIRQAPPVIRQAPAVIRQAPPVIRQAPPVIR
QAPPVIRQAPPLIRQAPPPIRPAPQVLATQPPLWQALPPPPPLRQAPQARLPAPQVQAAP
QVPTAPPATQVPAAPPAGPQVPQPVLPAPLSAPLSAPQAVHCPSIIWQAPKGQPPVPHEI
PTSMEFQEVQQTQALAWQAQKAPTHIWQPLPAQEAQRQAPPLVQLEQPFQGAPPSQKAVQ
IQLPPQQAQASGPQAEVPTLPLQPSWQAPPAVLQAQPGPPVAAANFPLGSAKSLMTPSGE
CRASSIDRRGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLPAAWKNLPATP
ETFAPSSSVFPATSQFQPASLNAFKGPSAASETPKSLPYALQDPFACVEALPAVPWVPQP
NMNASKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKATRKKKHLEAQEDSRG
HTLAFHDWQGPRPWENLNLSDWEVQSPIQVSGDWEHPNTPRGLSGWEGPSTSRILSGWEG
PSASWALSAWEGPSTSRALGLSESPGSSLPVVVSEVASVSPGSSATQDNSKVEAQPLSPL
DERANALVQFLLVKDQAKVPVQRSEMVKVILREYKDECLDIINRANNKLECAFGYQLKEI
DTKNHAYIIINKLGYHTGNLVASYLDRPKFGLLMVVLSLIFMKGNCVREDLIFNFLFKLG
LDVRETNGLFGNTKKLITEVFVRQKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRF
LAKLHKKDPQSWPFHYLEALAECEWEDTDEDEPDTGDSAHGPTSRPPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJ55	0.999	0.999	0.000	1249	1.000	1.000	Q9UJ55.pdb.gz	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
2	AFDB:Q9QZ04	0.217	0.212	2.179E-94	1284	0.645	0.628	Q9QZ04.pdb.gz	MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
3	PDB:7qcdE	0.141	0.610	1.499E-7	261	0.028	0.134	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
4	PDB:7tveF	0.139	0.578	8.760E-7	270	0.033	0.152	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
5	AFDB:A0A0B4KHZ9	0.030	0.032	4.834E-5	1151	0.127	0.138	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
6	AFDB:Q80XI3	0.044	0.038	6.235E-4	1579	0.127	0.101	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
7	AFDB:Q9JK11	0.049	0.051	8.547E-3	1163	0.143	0.153	Q9JK11.pdb.gz	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
8	PDB:7d58O	0.061	0.140	9.729E-3	490	0.029	0.073	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
9	AFDB:Q76E23	0.061	0.050	1.026E-2	1727	0.168	0.122	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
10	AFDB:Q9QX47	0.041	0.027	1.026E-2	2444	0.135	0.069	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
11	PDB:3cuqA	0.072	0.277	1.168E-2	219	0.018	0.105	3cuqA.pdb.gz
12	AFDB:Q6R0H7	0.049	0.053	1.309E-2	1133	0.138	0.152	Q6R0H7.pdb.gz	GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus OX=10090 GN=Gnas PE=1 SV=1
13	PDB:7a6hO	0.060	0.131	1.583E-2	512	0.018	0.043	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	AFDB:Q63803	0.050	0.052	2.005E-2	1144	0.131	0.142	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
15	AFDB:O43432	0.047	0.043	2.406E-2	1585	0.131	0.103	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
16	PDB:1w7pD	0.076	0.326	3.947E-2	171	0.019	0.140	1w7pD.pdb.gz
17	PDB:1u5tA	0.069	0.288	6.044E-2	213	0.015	0.089	1u5tA.pdb.gz
18	PDB:3euhC	0.072	0.256	6.423E-2	206	0.021	0.126	3euhC.pdb.gz
19	PDB:1ldjA	0.050	0.082	7.255E-2	725	0.022	0.037	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
20	PDB:5hs7A	0.056	0.498	1.045E-1	102	0.014	0.176	5hs7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QZ04	0.0	1252	1284	0.623	0.606	MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
2	Q9UJ55	0.0	2404	1249	1.000	1.000	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
3	Q9CPR8	4.03e-62	215	279	0.093	0.416	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
4	Q5H909	1.24e-61	224	588	0.082	0.175	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
5	Q5H907	1.43e-61	222	521	0.082	0.198	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
6	Q9UNF1	1.65e-61	224	606	0.082	0.170	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
7	E9Q098	1.89e-61	229	838	0.083	0.124	E9Q098_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
8	Q99PH7	2.12e-61	228	831	0.083	0.125	Q99PH7_MOUSE Magphinin-beta 2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
9	Q99PM5	7.11e-61	228	906	0.083	0.115	Q99PM5_MOUSE Magphinin-alpha OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
10	E9Q886	8.61e-61	229	972	0.083	0.107	E9Q886_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
11	Q99PW2	1.03e-60	228	965	0.083	0.108	Q99PW2_MOUSE Trophinin-2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
12	Q96MG7	3.13e-60	211	304	0.082	0.336	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
13	Q99NC2	3.29e-60	224	804	0.083	0.129	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
14	Q6DIC6	9.29e-59	225	2087	0.084	0.050	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
15	Q99PB3	1.17e-58	225	1987	0.084	0.053	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
16	Q80TJ5	1.41e-57	221	1736	0.084	0.060	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
17	G5E9N2	1.58e-56	211	681	0.081	0.148	G5E9N2_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=1
18	Q12816	1.30e-55	214	1431	0.082	0.072	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
19	Q001T8	3.51e-55	194	246	0.085	0.431	Q001T8_CHICK MAGE protein OS=Gallus gallus OX=9031 GN=mage PE=4 SV=1
20	E9Q160	5.01e-55	209	802	0.077	0.120	E9Q160_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	1.1e-17	76.0	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366404	0.994	Zinc finger protein RFP
2	9606.ENSP00000299138	0.939	Vacuolar protein sorting-associated protein 35
3	9606.ENSP00000313881	0.857	Probable E3 ubiquitin-protein ligase makorin-3
4	9606.ENSP00000382972	0.817	Small nuclear ribonucleoprotein-associated protein N
5	9606.ENSP00000333735	0.806	Nuclear pore-associated protein 1
6	9606.ENSP00000349325	0.804	Probable phospholipid-transporting ATPase VA
7	9606.ENSP00000343535	0.797	Ubiquitin carboxyl-terminal hydrolase 7
8	9606.ENSP00000232165	0.731	Ubiquitin-protein ligase E3A
9	9606.ENSP00000300688	0.689	ATP synthase subunit g, mitochondrial
10	9606.ENSP00000418944	0.655	Retrotransposon-derived protein PEG10
11	9606.ENSP00000323687	0.651	(E3-independent) E2 ubiquitin-conjugating enzyme
12	9606.ENSP00000359310	0.646	Putative chondrosarcoma-associated gene 1 protein
13	9606.ENSP00000268057	0.634	Bardet-Biedl syndrome 4 protein
14	9606.ENSP00000311196	0.623	Neuronal PAS domain-containing protein 4
15	9606.ENSP00000463201	0.613	SNRPN upstream reading frame
16	9606.ENSP00000358019	0.612	Non-structural maintenance of chromosomes element 4 homolog A
17	9606.ENSP00000480316	0.610	Gamma-tubulin complex component 5
18	9606.ENSP00000217386	0.605	Oxytocin-neurophysin 1
19	9606.ENSP00000430676	0.598	Potassium channel subfamily K member 9
20	9606.ENSP00000337618	0.596	Magnesium transporter NIPA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.996	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0051179	0.970	localization
GO:1901564	0.953	organonitrogen compound metabolic process
GO:0006810	0.949	transport
GO:0044238	0.920	primary metabolic process
GO:0019538	0.899	protein metabolic process
GO:0050794	0.893	regulation of cellular process
GO:0070647	0.891	protein modification by small protein conjugation or removal
GO:0016043	0.880	cellular component organization
GO:0016482	0.799	cytosolic transport
GO:0030029	0.790	actin filament-based process
GO:0016567	0.767	protein ubiquitination
GO:0000209	0.746	protein polyubiquitination
GO:0045010	0.721	actin nucleation
GO:0016197	0.691	endosomal transport
GO:0042147	0.663	retrograde transport, endosome to Golgi
GO:0070534	0.496	protein K63-linked ubiquitination
GO:0048518	0.408	positive regulation of biological process
GO:0048522	0.358	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.997	protein-containing complex
GO:0016020	0.997	membrane
GO:0012505	0.995	endomembrane system
GO:0031982	0.931	vesicle
GO:0005634	0.911	nucleus
GO:0031410	0.902	cytoplasmic vesicle
GO:0070013	0.718	intracellular organelle lumen
GO:0005768	0.659	endosome
GO:0098796	0.658	membrane protein complex
GO:0031981	0.529	nuclear lumen
GO:0005654	0.507	nucleoplasm
GO:0030904	0.424	retromer complex
GO:0071944	0.418	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]