StarFunc result for job id Q9UJ68

User Input

>input (235 residues)
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJ68	1.000	1.000	1.947E-52	235	1.000	1.000	Q9UJ68.pdb.gz	MSRA_HUMAN Mitochondrial peptide methionine sulfoxide reductase OS=Homo sapiens OX=9606 GN=MSRA PE=1 SV=1
2	AFDB:Q923M1	0.917	0.924	4.609E-46	233	0.851	0.858	Q923M1.pdb.gz	MSRA_RAT Mitochondrial peptide methionine sulfoxide reductase OS=Rattus norvegicus OX=10116 GN=Msra PE=1 SV=1
3	PDB:2l90A	0.828	0.919	6.740E-35	211	0.787	0.877	2l90A.pdb.gz
4	AFDB:E5RIA9	0.784	0.863	1.790E-34	213	0.779	0.859	E5RIA9.pdb.gz	E5RIA9_HUMAN peptide-methionine (S)-S-oxide reductase OS=Homo sapiens OX=9606 GN=MSRA PE=1 SV=1
5	AFDB:P0A744	0.846	0.937	1.283E-33	212	0.523	0.580	P0A744.pdb.gz	MSRA_ECOLI Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12) OX=83333 GN=msrA PE=1 SV=2
6	AFDB:Q9HUF1	0.860	0.940	2.002E-33	215	0.536	0.586	Q9HUF1.pdb.gz	MSRA_PSEAE Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrA PE=3 SV=1
7	PDB:1ff3A	0.835	0.929	1.004E-31	211	0.523	0.583	1ff3A.pdb.gz
8	AFDB:C8V8B9	0.639	0.704	6.545E-19	213	0.315	0.347	C8V8B9.pdb.gz	C8V8B9_EMENI peptide-methionine (S)-S-oxide reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10562 PE=3 SV=1
9	AFDB:P54150	0.637	0.582	2.648E-18	258	0.362	0.329	P54150.pdb.gz	MSRA4_ARATH Peptide methionine sulfoxide reductase A4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSR4 PE=1 SV=2
10	AFDB:Q9LY15	0.644	0.693	3.415E-18	218	0.336	0.362	Q9LY15.pdb.gz	MSRA2_ARATH Peptide methionine sulfoxide reductase A2 OS=Arabidopsis thaliana OX=3702 GN=MRSA2 PE=1 SV=1
11	AFDB:Q336R9	0.640	0.573	5.327E-18	263	0.357	0.319	Q336R9.pdb.gz	MSRA4_ORYSJ Peptide methionine sulfoxide reductase A4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRA4 PE=1 SV=2
12	AFDB:Q9LY14	0.642	0.745	1.472E-17	202	0.353	0.411	Q9LY14.pdb.gz	MSRA3_ARATH Peptide methionine sulfoxide reductase A3 OS=Arabidopsis thaliana OX=3702 GN=MSRA3 PE=1 SV=1
13	PDB:1nwaA	0.640	0.885	2.353E-16	168	0.260	0.363	1nwaA.pdb.gz
14	PDB:3pilA	0.635	0.806	7.386E-16	183	0.264	0.339	3pilA.pdb.gz
15	PDB:3pimC	0.498	0.701	1.068E-10	163	0.234	0.337	3pimC.pdb.gz
16	PDB:2fhjA	0.223	0.192	1.649E-1	296	0.081	0.064	2fhjA.pdb.gz	The structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
17	PDB:7qqnC	0.117	0.079	1.041	414	0.072	0.041	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6u425O	0.191	0.132	1.182	376	0.034	0.021	6u425O.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
19	PDB:3n5bA	0.133	0.238	1.342	112	0.030	0.062	3n5bA.pdb.gz	Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
20	PDB:5mguA	0.172	0.111	1.342	407	0.060	0.034	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJ68	4.93e-180	494	235	1.000	1.000	MSRA_HUMAN Mitochondrial peptide methionine sulfoxide reductase OS=Homo sapiens OX=9606 GN=MSRA PE=1 SV=1
2	Q923M1	6.60e-152	423	233	0.851	0.858	MSRA_RAT Mitochondrial peptide methionine sulfoxide reductase OS=Rattus norvegicus OX=10116 GN=Msra PE=1 SV=1
3	Q9D6Y7	9.37e-152	423	233	0.855	0.863	MSRA_MOUSE Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus OX=10090 GN=Msra PE=1 SV=1
4	E5RIA9	1.42e-136	384	213	0.770	0.850	E5RIA9_HUMAN peptide-methionine (S)-S-oxide reductase OS=Homo sapiens OX=9606 GN=MSRA PE=1 SV=1
5	Q9HUF1	7.44e-87	258	215	0.536	0.586	MSRA_PSEAE Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=msrA PE=3 SV=1
6	P0A744	2.33e-79	239	212	0.485	0.538	MSRA_ECOLI Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12) OX=83333 GN=msrA PE=1 SV=2
7	P54150	1.58e-44	151	258	0.323	0.295	MSRA4_ARATH Peptide methionine sulfoxide reductase A4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSR4 PE=1 SV=2
8	Q9LY14	6.60e-43	145	202	0.340	0.396	MSRA3_ARATH Peptide methionine sulfoxide reductase A3 OS=Arabidopsis thaliana OX=3702 GN=MSRA3 PE=1 SV=1
9	Q336R9	7.43e-42	145	263	0.319	0.285	MSRA4_ORYSJ Peptide methionine sulfoxide reductase A4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRA4 PE=1 SV=2
10	Q9LY15	1.22e-39	138	218	0.298	0.321	MSRA2_ARATH Peptide methionine sulfoxide reductase A2 OS=Arabidopsis thaliana OX=3702 GN=MRSA2 PE=1 SV=1
11	Q09859	1.52e-37	131	170	0.285	0.394	MSRA_SCHPO Probable peptide methionine sulfoxide reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mxr1 PE=3 SV=2
12	C8V8B9	5.21e-36	128	213	0.289	0.319	C8V8B9_EMENI peptide-methionine (S)-S-oxide reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10562 PE=3 SV=1
13	Q9XHG1	5.19e-32	123	448	0.302	0.158	Q9XHG1_GRAGA peptide-methionine (S)-S-oxide reductase OS=Gracilaria gracilis OX=2777 GN=PMSR PE=3 SV=1
14	P9WJM5	4.05e-28	107	182	0.251	0.324	MSRA_MYCTU Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=msrA PE=1 SV=1
15	P40029	5.01e-28	107	184	0.260	0.332	MSRA_YEAST Peptide methionine sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MXR1 PE=1 SV=1
16	Q57YH5	1.84e-27	105	177	0.285	0.379	Q57YH5_TRYB2 peptide-methionine (S)-S-oxide reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.110 PE=3 SV=1
17	P08761	2.99e-23	96.3	246	0.247	0.236	MSRA_DROME Peptide methionine sulfoxide reductase OS=Drosophila melanogaster OX=7227 GN=MsrA PE=1 SV=2
18	O02089	8.07e-21	88.6	207	0.226	0.256	O02089_CAEEL peptide-methionine (S)-S-oxide reductase OS=Caenorhabditis elegans OX=6239 GN=msra-1 PE=1 SV=1
19	P40559	0.13	35.8	946	0.068	0.017	INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP51 PE=1 SV=1
20	Q9VXW2	2.0	32.0	1224	0.085	0.016	Q9VXW2_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Prp5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01625 PMSR	9.5e-61	216.0	Peptide methionine sulfoxide reductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365693	0.993	Methionine-R-sulfoxide reductase B2, mitochondrial
2	9606.ENSP00000347324	0.991	Methionine-R-sulfoxide reductase B3
3	9606.ENSP00000363641	0.990	Thioredoxin
4	9606.ENSP00000199447	0.960	Thioredoxin domain-containing protein 3
5	9606.ENSP00000371923	0.909	Retinitis pigmentosa 1-like 1 protein
6	9606.ENSP00000451145	0.905	Uncharacterized protein
7	9606.ENSP00000355084	0.867	Methionine-R-sulfoxide reductase B1
8	9606.ENSP00000416583	0.846	Deoxyribose-phosphate aldolase
9	9606.ENSP00000301921	0.818	Transcription factor SOX-7
10	9606.ENSP00000434516	0.803	Thioredoxin reductase 1, cytoplasmic
11	9606.ENSP00000369739	0.799	Valacyclovir hydrolase
12	9606.ENSP00000370288	0.796	Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr and Tyr residues of target proteins (AMPylation) . May be a redox-active mitochondrial selenoprotein which interacts with a redox target protein .
13	9606.ENSP00000355518	0.794	Fumarate hydratase, mitochondrial
14	9606.ENSP00000359976	0.779	Cystathionine gamma-lyase
15	9606.ENSP00000452762	0.768	Electron transfer flavoprotein subunit alpha, mitochondrial
16	9606.ENSP00000216185	0.765	Thioredoxin, mitochondrial
17	9606.ENSP00000281243	0.757	Dihydropteridine reductase
18	9606.ENSP00000379845	0.757	4-aminobutyrate aminotransferase, mitochondrial
19	9606.ENSP00000303356	0.735	L-xylulose reductase
20	9606.ENSP00000371110	0.734	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008113	1.000	peptide-methionine (S)-S-oxide reductase activity
GO:0005515	0.971	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0006807	0.945	nitrogen compound metabolic process
GO:0050896	0.898	response to stimulus
GO:0006979	0.875	response to oxidative stress
GO:1901564	0.856	organonitrogen compound metabolic process
GO:0044281	0.798	small molecule metabolic process
GO:0043170	0.789	macromolecule metabolic process
GO:0019752	0.745	carboxylic acid metabolic process
GO:0006520	0.674	amino acid metabolic process
GO:0019538	0.630	protein metabolic process
GO:0000096	0.547	sulfur amino acid metabolic process
GO:1901605	0.476	alpha-amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0031981	0.990	nuclear lumen
GO:0005576	0.962	extracellular region
GO:0005829	0.958	cytosol
GO:0005654	0.957	nucleoplasm
GO:0016020	0.945	membrane
GO:0043232	0.942	intracellular non-membrane-bounded organelle
GO:0070062	0.901	extracellular exosome
GO:0005886	0.894	plasma membrane
GO:0005739	0.743	mitochondrion
GO:0005856	0.553	cytoskeleton
GO:0012505	0.387	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14217	1.000	[thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(S)-S-oxide-[protein]
EC:1.8.4.11	1.000	peptide-methionine (S)-S-oxide reductase.

[back to server]