StarFunc result for job id Q9UJ90

User Input

>input (142 residues)
MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAY
LYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQ
AEGRRQLASEGLPALAQGAERV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJ90	1.000	1.000	5.921E-21	142	1.000	1.000	Q9UJ90.pdb.gz	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
2	AFDB:P47940	0.175	0.147	1.844E-1	175	0.232	0.189	P47940.pdb.gz	RES18_RAT Regulated endocrine-specific protein 18 OS=Rattus norvegicus OX=10116 GN=Resp18 PE=2 SV=1
3	AFDB:Q54KQ7	0.232	0.055	1.980E-1	655	0.099	0.021	Q54KQ7.pdb.gz	SPAST_DICDI Spastin OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287165 PE=3 SV=1
4	AFDB:P47939	0.176	0.151	2.283E-1	175	0.246	0.200	P47939.pdb.gz	RES18_MOUSE Regulated endocrine-specific protein 18 OS=Mus musculus OX=10090 GN=Resp18 PE=2 SV=1
5	AFDB:Q2F908	0.189	0.070	2.452E-1	435	0.162	0.053	Q2F908.pdb.gz	Q2F908_ORYSJ Cytochrome c biogenesis Fc OS=Oryza sativa subsp. japonica OX=39947 GN=ccmFc PE=4 SV=1
6	AFDB:O76368	0.311	0.074	4.336E-1	716	0.155	0.031	O76368.pdb.gz	COL99_CAEEL Putative cuticle collagen 99 OS=Caenorhabditis elegans OX=6239 GN=col-99 PE=1 SV=4
7	AFDB:O54912	0.160	0.067	6.649E-1	411	0.211	0.073	O54912.pdb.gz	KCNK3_RAT Potassium channel subfamily K member 3 OS=Rattus norvegicus OX=10116 GN=Kcnk3 PE=2 SV=1
8	AFDB:Q8IDG8	0.246	0.254	7.667E-1	137	0.120	0.124	Q8IDG8.pdb.gz	Q8IDG8_PLAF7 Membrane associated histidine-rich protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1353200 PE=4 SV=1
9	PDB:2ndjA	0.191	0.253	9.395E-1	103	0.197	0.272	2ndjA.pdb.gz
10	AFDB:Q6VYH9	0.160	0.077	1.019	334	0.113	0.048	Q6VYH9.pdb.gz	HSH2D_MOUSE Hematopoietic SH2 domain-containing protein OS=Mus musculus OX=10090 GN=Hsh2d PE=2 SV=1
11	AFDB:Q38A90	0.202	0.129	1.095	282	0.148	0.074	Q38A90.pdb.gz	Q38A90_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1670 PE=4 SV=1
12	PDB:5lj5O	0.171	0.088	1.661	283	0.134	0.067	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:7mqaNA	0.198	0.100	2.372	295	0.127	0.061	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:2k21A	0.234	0.254	5.194	129	0.183	0.202	2k21A.pdb.gz
15	PDB:6zr2h	0.193	0.197	5.194	138	0.134	0.138	6zr2h.pdb.gz	Structure of inhibitor-bound mammalian complex I.
16	PDB:3j79V	0.140	0.130	6.907	155	0.085	0.077	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:7cgpJ	0.254	0.398	7.417	83	0.106	0.181	7cgpJ.pdb.gz
18	PDB:7d5s5J	0.208	0.198	8.552	151	0.106	0.099	7d5s5J.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:3jb9W	0.193	0.074	9.184	426	0.148	0.049	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:7qskm	0.150	0.161	9.184	128	0.141	0.156	7qskm.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJ90	1.88e-100	286	142	1.000	1.000	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
2	Q2N1I1	3.06e-07	47.8	99	0.190	0.273	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
3	Q9WTW2	3.39e-07	47.8	103	0.134	0.184	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
4	Q9JJV7	3.49e-07	47.8	107	0.134	0.178	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
5	Q6IAE6	3.76e-07	47.8	103	0.190	0.262	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
6	Q9Y6H6	3.76e-07	47.8	103	0.190	0.262	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
7	P15383	0.029	35.0	130	0.106	0.115	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
8	P23299	0.031	35.0	129	0.106	0.116	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
9	P15382	0.039	34.7	129	0.106	0.116	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
10	Q6FHJ6	0.067	33.9	129	0.106	0.116	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
11	Q71FD8	0.12	33.5	170	0.077	0.065	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
12	Q8WWG9	0.21	33.1	221	0.077	0.050	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
13	Q9VW47	0.63	32.3	2531	0.120	0.007	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
14	Q8INF7	1.8	30.8	845	0.113	0.019	DAAF5_DROME Dynein axonemal assembly factor 5 OS=Drosophila melanogaster OX=7227 GN=Dnaaf5 PE=2 SV=1
15	P82923	4.3	29.3	293	0.106	0.051	RT02_BOVIN Small ribosomal subunit protein uS2m OS=Bos taurus OX=9913 GN=MRPS2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02060 ISK_Channel	0.092	23.9	Slow voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.891	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000262186	0.864	Potassium voltage-gated channel subfamily H member 2
3	9606.ENSP00000310557	0.856	Potassium voltage-gated channel subfamily E member 3
4	9606.ENSP00000337255	0.836	Potassium voltage-gated channel subfamily E member 1
5	9606.ENSP00000290310	0.830	Potassium voltage-gated channel subfamily E member 2
6	9606.ENSP00000281830	0.822	Potassium voltage-gated channel subfamily E member 4
7	9606.ENSP00000262844	0.819	AMME syndrome candidate gene 1 protein
8	9606.ENSP00000339787	0.768	Long-chain-fatty-acid--CoA ligase 4
9	9606.ENSP00000348573	0.740	A-kinase anchor protein 9
10	9606.ENSP00000218006	0.734	Retinal guanylyl cyclase 2
11	9606.ENSP00000218004	0.721	NTF2-related export protein 2
12	9606.ENSP00000319591	0.716	Potassium voltage-gated channel subfamily D member 3
13	9606.ENSP00000226105	0.705	Ran guanine nucleotide release factor
14	9606.ENSP00000376523	0.696	Sodium channel subunit beta-3
15	9606.ENSP00000256953	0.691	Ras-related and estrogen-regulated growth inhibitor
16	9606.ENSP00000278947	0.690	Sodium channel subunit beta-2
17	9606.ENSP00000396915	0.689	Sodium channel subunit beta-1
18	9606.ENSP00000365256	0.682	H(+)/Cl(-) exchange transporter 5
19	9606.ENSP00000295951	0.669	Sarcolemmal membrane-associated protein
20	9606.ENSP00000240662	0.668	ATP-sensitive inward rectifier potassium channel 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0015459	1.000	potassium channel regulator activity
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0086008	0.990	voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060048	0.992	cardiac muscle contraction
GO:0070252	0.991	actin-mediated cell contraction
GO:0050794	0.990	regulation of cellular process
GO:0061337	0.990	cardiac conduction
GO:0002027	0.990	regulation of heart rate
GO:0086001	0.987	cardiac muscle cell action potential
GO:0086065	0.984	cell communication involved in cardiac conduction
GO:0043270	0.977	positive regulation of monoatomic ion transport
GO:1901379	0.976	regulation of potassium ion transmembrane transport
GO:0007267	0.969	cell-cell signaling
GO:0032412	0.969	regulation of monoatomic ion transmembrane transporter activity
GO:0043267	0.947	negative regulation of potassium ion transport
GO:0048523	0.938	negative regulation of cellular process
GO:2001257	0.937	regulation of cation channel activity
GO:1904064	0.935	positive regulation of cation transmembrane transport
GO:1904063	0.930	negative regulation of cation transmembrane transport
GO:0043268	0.909	positive regulation of potassium ion transport
GO:1901381	0.887	positive regulation of potassium ion transmembrane transport
GO:0006811	0.459	monoatomic ion transport
GO:1901380	0.440	negative regulation of potassium ion transmembrane transport
GO:0086091	0.418	regulation of heart rate by cardiac conduction
GO:0086066	0.401	atrial cardiac muscle cell to AV node cell communication
GO:0060307	0.383	regulation of ventricular cardiac muscle cell membrane repolarization
GO:0086014	0.382	atrial cardiac muscle cell action potential
GO:0086005	0.363	ventricular cardiac muscle cell action potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008076	0.995	voltage-gated potassium channel complex
GO:0043231	0.391	intracellular membrane-bounded organelle
GO:0005737	0.339	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]