StarFunc result for job id Q9UJ98

User Input

>input (1225 residues)
MSSPLQRAVGDTKRALSASSSSSASLPFDDRDSNHTSEGNGDSLLADEDTDFEDSLNRNV
KKRAAKRPPKTTPVAKHPKKGSRVVHRHSRKQSEPPANDLFNAVKAAKSDMQSLVDEWLD
SYKQDQDAGFLELVNFFIQSCGCKGIVTPEMFKKMSNSEIIQHLTEQFNEDSGDYPLIAP
GPSWKKFQGSFCEFVRTLVCQCQYSLLYDGFPMDDLISLLTGLSDSQVRAFRHTSTLAAM
KLMTSLVKVALQLSVHQDNNQRQYEAERNKGPGQRAPERLESLLEKRKELQEHQEEIEGM
MNALFRGVFVHRYRDVLPEIRAICIEEIGCWMQSYSTSFLTDSYLKYIGWTLHDKHREVR
LKCVKALKGLYGNRDLTTRLELFTSRFKDRMVSMVMDREYDVAVEAVRLLILILKNMEGV
LTDADCESVYPVVYASHRGLASAAGEFLYWKLFYPECEIRMMGGREQRQSPGAQRTFFQL
LLSFFVESELHDHAAYLVDSLWDCAGARLKDWEGLTSLLLEKDQNLGDVQESTLIEILVS
SARQASEGHPPVGRVTGRKGLTSKERKTQADDRVKLTEHLIPLLPQLLAKFSADAEKVTP
LLQLLSCFDLHIYCTGRLEKHLELFLQQLQEVVVKHAEPAVLEAGAHALYLLCNPEFTFF
SRADFARSQLVDLLTDRFQQELEELLQSSFLDEDEVYNLAATLKRLSAFYNTHDLTRWEL
YEPCCQLLQKAVDTGEVPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAF
CELCQSCLSDVDTEIQEQAFVLLSDLLLIFSPQMIVGGRDFLRPLVFFPEATLQSELASF
LMDHVFIQPGDLGSGDSQEDHLQIERLHQRRRLLAGFCKLLLYGVLEMDAASDVFKHYNK
FYNDYGDIIKETLTRARQIDRSHCSRILLLSLKQLYTELLQEHGPQGLNELPAFIEMRDL
ARRFALSFGPQQLQNRDLVVMLHKEGIQFSLSELPPAGSSNQPPNLAFLELLSEFSPRLF
HQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEG
PAKPNREDVSSSQEESLQLNSIPPTPTLTSTAVKSRQPLWGLKEMEEEDGSELDFAQGQP
VAGTERSRFLGPQYFQTPHNPSGPGLGNQLMRLSLMEEDEEEELEIQDESNEERQDTDMQ
ASSYSSTSERGLDLLDSTELDIEDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D6W5U7	0.803	0.803	0.000	1226	1.000	0.999	D6W5U7.pdb.gz	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
2	AFDB:Q99M76	0.818	0.798	0.000	1256	0.780	0.761	Q99M76.pdb.gz	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
3	AFDB:Q8WVM7	0.779	0.760	1.286E-75	1258	0.482	0.470	Q8WVM7.pdb.gz	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
4	AFDB:O35638	0.767	0.763	3.006E-75	1231	0.479	0.477	O35638.pdb.gz	STAG2_MOUSE Cohesin subunit SA-2 OS=Mus musculus OX=10090 GN=Stag2 PE=1 SV=3
5	AFDB:Q9DGN0	0.776	0.796	1.234E-73	1194	0.460	0.472	Q9DGN0.pdb.gz	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
6	AFDB:Q9DGN1	0.781	0.757	1.887E-73	1265	0.474	0.459	Q9DGN1.pdb.gz	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
7	PDB:6qnxA	0.733	0.964	8.054E-66	928	0.437	0.577	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
8	PDB:6wg3D	0.707	0.917	2.932E-59	932	0.441	0.579	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
9	AFDB:Q9VM62	0.733	0.794	2.969E-58	1127	0.352	0.382	Q9VM62.pdb.gz	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
10	AFDB:Q19555	0.727	0.810	3.345E-50	1096	0.273	0.305	Q19555.pdb.gz	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
11	AFDB:O82265	0.640	0.706	1.642E-36	1098	0.211	0.235	O82265.pdb.gz	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
12	PDB:6h8qA	0.517	0.697	2.782E-15	879	0.127	0.177	6h8qA.pdb.gz	Structural basis for Scc3-dependent cohesin recruitment to chromatin.
13	AFDB:Q498H0	0.263	0.233	2.320E-8	1448	0.139	0.117	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
14	PDB:4jlqA	0.210	0.278	1.657E-7	840	0.104	0.151	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:4a0cA	0.169	0.177	5.142E-7	1155	0.109	0.115	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:6xu2A	0.223	0.244	6.137E-7	1091	0.102	0.115	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
17	PDB:6tc0C	0.168	0.191	8.742E-7	994	0.101	0.125	6tc0C.pdb.gz
18	PDB:5oqrA	0.309	0.459	1.337E-6	751	0.085	0.138	5oqrA.pdb.gz
19	PDB:7wttK	0.204	0.228	1.595E-6	1022	0.092	0.111	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
20	PDB:3w3uA	0.225	0.255	2.439E-6	1030	0.100	0.118	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6W5U7	0.0	2518	1226	1.000	0.999	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
2	O18415	0.0	782	1116	0.348	0.382	O18415_DROME Nuclear protein SA OS=Drosophila melanogaster OX=7227 GN=SA1 PE=2 SV=1
3	O35638	0.0	1144	1231	0.487	0.485	STAG2_MOUSE Cohesin subunit SA-2 OS=Mus musculus OX=10090 GN=Stag2 PE=1 SV=3
4	O70576	0.0	1852	1240	0.778	0.769	STAG3_MOUSE Cohesin subunit SA-3 OS=Mus musculus OX=10090 GN=Stag3 PE=1 SV=2
5	Q19555	0.0	568	1096	0.272	0.304	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
6	Q68DW7	0.0	855	998	0.389	0.478	Q68DW7_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
7	Q8N3U4	0.0	1145	1231	0.488	0.486	STAG2_HUMAN Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3
8	Q8WVM7	0.0	1136	1258	0.478	0.465	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
9	Q99M76	0.0	1840	1256	0.781	0.762	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
10	Q9D3E6	0.0	1134	1258	0.478	0.466	STAG1_MOUSE Cohesin subunit SA-1 OS=Mus musculus OX=10090 GN=Stag1 PE=1 SV=3
11	Q9DGN0	0.0	1110	1194	0.452	0.464	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
12	Q9DGN1	0.0	1092	1265	0.464	0.450	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
13	Q9UJ98	0.0	2524	1225	1.000	1.000	STAG3_HUMAN Cohesin subunit SA-3 OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=2
14	Q9VM62	0.0	781	1127	0.347	0.377	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
15	C9JTG4	1.45e-93	298	144	0.118	1.000	C9JTG4_HUMAN Stromal antigen 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=8
16	O82265	1.44e-70	259	1098	0.208	0.232	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
17	C9JYW5	2.58e-69	229	112	0.091	1.000	C9JYW5_HUMAN Stromal antigen 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
18	C9JJQ0	1.76e-63	217	232	0.087	0.461	C9JJQ0_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
19	C9J3T3	9.49e-61	208	188	0.099	0.644	C9J3T3_HUMAN Stromal antigen 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
20	Q9W0F4	6.88e-48	188	973	0.189	0.238	Q9W0F4_DROME Stromalin-2 OS=Drosophila melanogaster OX=7227 GN=SA2 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	1.2	20.6	non-SMC mitotic condensation complex subunit 1
2	PF02985 HEAT	69	15.1	HEAT repeat
3	PF13646 HEAT_2	1.5e+02	14.2	HEAT repeats
4	PF20168 PDS5	9.5	15.5	Sister chromatid cohesion protein PDS5 protein
5	PF08514 STAG	5e-31	118.3	STAG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477973

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354720	0.999	Structural maintenance of chromosomes protein 3
2	9606.ENSP00000323421	0.998	Structural maintenance of chromosomes protein 1A
3	9606.ENSP00000350036	0.998	Structural maintenance of chromosomes protein 1B
4	9606.ENSP00000297338	0.997	Double-strand-break repair protein rad21 homolog
5	9606.ENSP00000482546	0.996	Meiotic recombination protein REC8 homolog
6	9606.ENSP00000386414	0.989	Double-strand-break repair protein rad21-like protein 1
7	9606.ENSP00000350447	0.950	Shugoshin 2
8	9606.ENSP00000282516	0.945	Nipped-B-like protein
9	9606.ENSP00000376658	0.916	Synaptonemal complex protein 3
10	9606.ENSP00000358535	0.913	Synaptonemal complex protein 1
11	9606.ENSP00000218089	0.907	Cohesin subunit SA-2
12	9606.ENSP00000372689	0.906	Cohesin subunit SA-1
13	9606.ENSP00000350162	0.896	Synaptonemal complex protein 2
14	9606.ENSP00000303427	0.883	Sister chromatid cohesion protein PDS5 homolog A
15	9606.ENSP00000341282	0.882	Synaptonemal complex central element protein 1
16	9606.ENSP00000293695	0.861	Synaptonemal complex central element protein 2
17	9606.ENSP00000280358	0.844	Testis-expressed protein 12
18	9606.ENSP00000257934	0.835	Separin
19	9606.ENSP00000354957	0.826	Structural maintenance of chromosomes protein 5
20	9606.ENSP00000349961	0.822	Structural maintenance of chromosomes protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007049	0.995	cell cycle
GO:0000003	0.985	reproduction
GO:0071840	0.971	cellular component organization or biogenesis
GO:0006996	0.955	organelle organization
GO:0051276	0.950	chromosome organization
GO:0000280	0.945	nuclear division
GO:0007059	0.937	chromosome segregation
GO:0061982	0.934	meiosis I cell cycle process
GO:0098813	0.927	nuclear chromosome segregation
GO:0007127	0.913	meiosis I
GO:0007129	0.894	homologous chromosome pairing at meiosis
GO:0000819	0.746	sister chromatid segregation
GO:0007062	0.478	sister chromatid cohesion
GO:0061983	0.445	meiosis II cell cycle process
GO:0045144	0.443	meiotic sister chromatid segregation
GO:0051177	0.417	meiotic sister chromatid cohesion
GO:0022607	0.371	cellular component assembly
GO:0070193	0.363	synaptonemal complex organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.999	chromosome
GO:0032991	0.988	protein-containing complex
GO:0000228	0.914	nuclear chromosome
GO:0000793	0.805	condensed chromosome
GO:0005730	0.734	nucleolus
GO:0005737	0.642	cytoplasm
GO:0044815	0.572	DNA packaging complex
GO:0005576	0.556	extracellular region
GO:0008278	0.522	cohesin complex
GO:0000794	0.515	condensed nuclear chromosome
GO:0099086	0.360	synaptonemal structure
GO:0000795	0.335	synaptonemal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]