StarFunc result for job id Q9UJA2

User Input

>input (301 residues)
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRL
PGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGL
APVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISIL
YVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF
ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIK
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJA2	1.000	1.000	1.263E-42	301	1.000	1.000	Q9UJA2.pdb.gz	CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens OX=9606 GN=CRLS1 PE=1 SV=1
2	AFDB:Q80ZM8	0.842	0.837	3.070E-36	303	0.864	0.858	Q80ZM8.pdb.gz	CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus OX=10090 GN=Crls1 PE=1 SV=1
3	AFDB:Q8MZC4	0.651	0.609	7.055E-18	322	0.316	0.295	Q8MZC4.pdb.gz	CRLS1_DROME Probable cardiolipin synthase (CMP-forming) OS=Drosophila melanogaster OX=7227 GN=CLS PE=2 SV=1
4	AFDB:O01916	0.613	0.746	2.077E-14	246	0.299	0.366	O01916.pdb.gz	CRLS1_CAEEL Probable cardiolipin synthase (CMP-forming) OS=Caenorhabditis elegans OX=6239 GN=crls-1 PE=3 SV=1
5	AFDB:Q93YW7	0.570	0.506	5.890E-12	341	0.296	0.261	Q93YW7.pdb.gz	CLS_ARATH Cardiolipin synthase (CMP-forming), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLS PE=1 SV=1
6	AFDB:O80952	0.445	0.453	2.237E-8	296	0.213	0.216	O80952.pdb.gz	PGPS1_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGPS1 PE=1 SV=1
7	AFDB:Q9M2W3	0.516	0.649	1.125E-6	233	0.169	0.219	Q9M2W3.pdb.gz	PGPS2_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=PGPS2 PE=1 SV=1
8	AFDB:Q386Y0	0.164	0.080	2.805E-2	800	0.133	0.050	Q386Y0.pdb.gz	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1
9	PDB:6h5aB	0.396	0.538	2.921E-2	209	0.100	0.144	6h5aB.pdb.gz	Structure ofMycobacterium tuberculosisphosphatidylinositol phosphate synthase reveals mechanism of substrate binding and metal catalysis.
10	AFDB:O45923	0.176	0.143	4.215E-2	410	0.156	0.115	O45923.pdb.gz	TTM1_CAEEL Zinc transporter ttm-1 OS=Caenorhabditis elegans OX=6239 GN=ttm-1 PE=1 SV=1
11	AFDB:A0A0B4LFF3	0.109	0.048	1.108E-1	936	0.126	0.041	A0A0B4LFF3.pdb.gz	A0A0B4LFF3_DROME Stac-like, isoform P OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	PDB:4o9yA	0.089	0.018	4.556E-1	2490	0.113	0.014	4o9yA.pdb.gz
13	PDB:5zugA	0.200	0.284	4.556E-1	182	0.066	0.110	5zugA.pdb.gz
14	PDB:6s7tA	0.135	0.077	7.578E-1	706	0.116	0.050	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
15	PDB:6k4jA	0.165	0.202	1.260	220	0.080	0.109	6k4jA.pdb.gz
16	PDB:5ykfB	0.136	0.040	1.326	1309	0.100	0.023	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
17	PDB:5a1vK	0.136	0.046	1.468	1126	0.100	0.027	5a1vK.pdb.gz
18	PDB:3c98B	0.166	0.205	1.800	230	0.060	0.078	3c98B.pdb.gz
19	PDB:7jpvE	0.096	0.187	1.992	139	0.070	0.151	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
20	PDB:5hh3C	0.116	0.096	2.096	393	0.066	0.051	5hh3C.pdb.gz	Structure of OxyAtei : completing our picture of the glycopeptide antibiotic producing Cytochrome P450 cascade.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJA2	0.0	603	301	1.000	1.000	CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens OX=9606 GN=CRLS1 PE=1 SV=1
2	Q5U2V5	3.46e-177	493	302	0.854	0.851	CRLS1_RAT Cardiolipin synthase (CMP-forming) OS=Rattus norvegicus OX=10116 GN=Crls1 PE=2 SV=1
3	Q80ZM8	7.75e-171	477	303	0.854	0.848	CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus OX=10090 GN=Crls1 PE=1 SV=1
4	Q8MZC4	5.76e-60	196	322	0.316	0.295	CRLS1_DROME Probable cardiolipin synthase (CMP-forming) OS=Drosophila melanogaster OX=7227 GN=CLS PE=2 SV=1
5	O01916	2.46e-54	179	246	0.289	0.354	CRLS1_CAEEL Probable cardiolipin synthase (CMP-forming) OS=Caenorhabditis elegans OX=6239 GN=crls-1 PE=3 SV=1
6	O13899	5.83e-30	120	570	0.213	0.112	CRLS1_SCHPO Cardiolipin synthase (CMP-forming) / mitochondrial hydrolase fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crd1 PE=1 SV=2
7	Q93YW7	2.52e-27	110	341	0.239	0.211	CLS_ARATH Cardiolipin synthase (CMP-forming), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLS PE=1 SV=1
8	Q07560	9.52e-24	100	283	0.196	0.208	CRD1_YEAST Cardiolipin synthase (CMP-forming) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRD1 PE=1 SV=1
9	P0ABF8	8.48e-09	56.2	182	0.159	0.264	PGSA_ECOLI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pgsA PE=1 SV=2
10	C0H5B7	1.36e-05	47.4	209	0.083	0.120	C0H5B7_PLAF7 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1315600 PE=3 SV=1
11	P9WPG3	1.16e-04	44.7	209	0.096	0.139	PGSA_MYCTU Probable phosphatidylglycerophosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgsA3 PE=3 SV=1
12	O80952	7.58e-04	42.7	296	0.110	0.111	PGPS1_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGPS1 PE=1 SV=1
13	Q9M2W3	0.001	42.4	233	0.140	0.180	PGPS2_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=PGPS2 PE=1 SV=1
14	B6V6V5	0.34	34.7	378	0.076	0.061	KSHA4_RHORH 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Rhodococcus rhodochrous OX=1829 GN=kshA PE=1 SV=1
15	P70500	0.62	33.5	213	0.093	0.131	CDIPT_RAT CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Rattus norvegicus OX=10116 GN=Cdipt PE=1 SV=1
16	A0FGR8	1.6	33.1	921	0.113	0.037	ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1
17	A8JNP3	1.6	33.1	1006	0.066	0.020	A8JNP3_DROME Metal response element-binding transcription Factor-1, isoform C OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
18	O77475	1.9	32.3	392	0.080	0.061	CPESY_DROME Ceramide phosphoethanolamine synthase OS=Drosophila melanogaster OX=7227 GN=Cpes PE=1 SV=1
19	O14735	4.9	30.8	213	0.090	0.127	CDIPT_HUMAN CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1
20	Q389A6	5.1	31.2	679	0.120	0.053	Q389A6_TRYB2 Glutamate--cysteine ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1360 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01066 CDP-OH_P_transf	3.5e-20	84.5	CDP-alcohol phosphatidyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262764	0.983	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
2	9606.ENSP00000419879	0.978	Phosphatidate cytidylyltransferase 2
3	9606.ENSP00000469981	0.978	Tafazzin
4	9606.ENSP00000295887	0.970	Phosphatidate cytidylyltransferase 1
5	9606.ENSP00000310551	0.970	Lysocardiolipin acyltransferase 1
6	9606.ENSP00000325958	0.967	Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
7	9606.ENSP00000219789	0.954	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
8	9606.ENSP00000262134	0.938	Lysophosphatidylcholine acyltransferase 2
9	9606.ENSP00000283415	0.933	Lysophosphatidylcholine acyltransferase 1
10	9606.ENSP00000355964	0.933	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
11	9606.ENSP00000317300	0.914	Lysophospholipid acyltransferase LPCAT4
12	9606.ENSP00000368164	0.846	DNA helicase MCM8
13	9606.ENSP00000371586	0.815	Phosphatidylserine decarboxylase proenzyme, mitochondrial
14	9606.ENSP00000398596	0.772	Phosphatidate cytidylyltransferase, mitochondrial
15	9606.ENSP00000367346	0.761	Arginine-hydroxylase NDUFAF5, mitochondrial
16	9606.ENSP00000254928	0.752	GTPase Era, mitochondrial
17	9606.ENSP00000368135	0.736	Leucine-rich repeat neuronal protein 4
18	9606.ENSP00000240651	0.734	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
19	9606.ENSP00000246024	0.726	Thioredoxin related transmembrane protein 4
20	9606.ENSP00000309175	0.725	Probable RNA-binding protein EIF1AD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030572	1.000	phosphatidyltransferase activity
GO:0016747	0.995	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0071617	0.993	lysophospholipid acyltransferase activity
GO:0008374	0.993	O-acyltransferase activity
GO:0016411	0.972	acylglycerol O-acyltransferase activity
GO:0003841	0.942	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0043337	0.766	cardiolipin synthase (CMP-forming)
GO:0005488	0.666	binding
GO:0047144	0.649	2-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.387	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006629	0.983	lipid metabolic process
GO:0006644	0.973	phospholipid metabolic process
GO:0009058	0.967	biosynthetic process
GO:0046486	0.965	glycerolipid metabolic process
GO:0008610	0.959	lipid biosynthetic process
GO:0044249	0.946	cellular biosynthetic process
GO:0006650	0.937	glycerophospholipid metabolic process
GO:0008654	0.889	phospholipid biosynthetic process
GO:0045017	0.884	glycerolipid biosynthetic process
GO:0046471	0.845	phosphatidylglycerol metabolic process
GO:0046474	0.732	glycerophospholipid biosynthetic process
GO:0050896	0.333	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.997	membrane
GO:0031090	0.951	organelle membrane
GO:0005740	0.907	mitochondrial envelope
GO:0019866	0.873	organelle inner membrane
GO:0031966	0.857	mitochondrial membrane
GO:0005743	0.820	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.
EC:2.3.1.-	0.995	Transferring groups other than amino-acyl groups.
RHEA:19709	0.942	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.942	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:32931	0.766	1,2-diacyl-sn-glycero-3-phospho-(1'-sn-glycerol) + a CDP-1,2-diacyl-sn-glycerol = a cardiolipin + CMP + H(+)
EC:2.7.8.41	0.766	cardiolipin synthase (CMP-forming).
RHEA:14233	0.649	a 2-acyl-sn-glycerol 3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.52	0.649	2-acylglycerol-3-phosphate O-acyltransferase.

[back to server]