StarFunc result for job id Q9UJC5

User Input

>input (107 residues)
MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPT
QGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BG73	0.962	0.962	2.174E-20	107	0.935	0.935	Q8BG73.pdb.gz	SH3L2_MOUSE SH3 domain-binding glutamic acid-rich-like protein 2 OS=Mus musculus OX=10090 GN=Sh3bgrl2 PE=1 SV=1
2	PDB:2ct6A	0.857	0.827	5.773E-16	111	0.907	0.874	2ct6A.pdb.gz
3	AFDB:O75368	0.943	0.885	1.270E-15	114	0.626	0.588	O75368.pdb.gz	SH3L1_HUMAN Adapter SH3BGRL OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1
4	PDB:1u6tA	0.934	0.827	1.761E-14	121	0.617	0.545	1u6tA.pdb.gz
5	PDB:1wryA	0.921	0.818	1.350E-13	121	0.626	0.554	1wryA.pdb.gz
6	AFDB:Q9NFP5	0.840	0.578	4.109E-11	158	0.364	0.247	Q9NFP5.pdb.gz	SH3BG_DROME SH3 domain-binding glutamic acid-rich protein homolog OS=Drosophila melanogaster OX=7227 GN=Sh3beta PE=1 SV=2
7	AFDB:B2RZ27	0.783	0.894	7.389E-9	93	0.346	0.398	B2RZ27.pdb.gz	SH3L3_RAT SH3 domain-binding glutamic acid-rich-like protein 3 OS=Rattus norvegicus OX=10116 GN=Sh3bgrl3 PE=1 SV=1
8	PDB:1sj6A	0.716	0.796	2.110E-7	95	0.336	0.379	1sj6A.pdb.gz
9	AFDB:Q57X23	0.766	0.330	4.958E-7	270	0.215	0.085	Q57X23.pdb.gz	Q57X23_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.210 PE=3 SV=1
10	AFDB:Q5T123	0.605	0.728	1.326E-5	88	0.252	0.307	Q5T123.pdb.gz	Q5T123_HUMAN SH3 domain binding glutamate rich protein like 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
11	PDB:3grxA	0.627	0.790	7.322E-5	82	0.150	0.195	3grxA.pdb.gz	NMR structure of Escherichia coli glutaredoxin 3-glutathione mixed disulfide complex: implications for the enzymatic mechanism.
12	AFDB:P43597	0.683	0.067	1.323E-4	1233	0.140	0.012	P43597.pdb.gz	YFI6_YEAST Uncharacterized protein YFR016C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFR016C PE=1 SV=1
13	AFDB:Q9LH89	0.757	0.206	1.962E-4	428	0.178	0.044	Q9LH89.pdb.gz	Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabidopsis thaliana OX=3702 GN=At3g28850 PE=4 SV=1
14	AFDB:P0AC62	0.644	0.809	2.238E-4	83	0.140	0.181	P0AC62.pdb.gz	GLRX3_ECOLI Glutaredoxin 3 OS=Escherichia coli (strain K12) OX=83333 GN=grxC PE=1 SV=2
15	AFDB:Q9FGG8	0.703	0.301	2.726E-4	273	0.168	0.066	Q9FGG8.pdb.gz	Q9FGG8_ARATH At5g58530 OS=Arabidopsis thaliana OX=3702 GN=MQJ2.15 PE=1 SV=1
16	PDB:3qmxA	0.598	0.640	3.320E-4	99	0.187	0.202	3qmxA.pdb.gz
17	PDB:4n11A	0.568	0.564	4.034E-3	108	0.131	0.130	4n11A.pdb.gz	Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
18	PDB:4rqrA	0.579	0.579	7.288E-3	107	0.168	0.168	4rqrA.pdb.gz	Cysteine Specific Targeting of the Functionally Distinct Peroxiredoxin and Glutaredoxin Proteins by the Investigational Disulfide BNP7787.
19	PDB:1grxA	0.494	0.582	1.406E-2	85	0.187	0.235	1grxA.pdb.gz	NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
20	PDB:2jadA	0.580	0.203	1.406E-2	346	0.140	0.043	2jadA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJC5	5.51e-76	221	107	1.000	1.000	SH3L2_HUMAN SH3 domain-binding glutamic acid-rich-like protein 2 OS=Homo sapiens OX=9606 GN=SH3BGRL2 PE=1 SV=2
2	Q8BG73	8.94e-72	210	107	0.935	0.935	SH3L2_MOUSE SH3 domain-binding glutamic acid-rich-like protein 2 OS=Mus musculus OX=10090 GN=Sh3bgrl2 PE=1 SV=1
3	O75368	9.65e-44	140	114	0.626	0.588	SH3L1_HUMAN Adapter SH3BGRL OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1
4	Q9NFP5	5.01e-19	78.6	158	0.383	0.259	SH3BG_DROME SH3 domain-binding glutamic acid-rich protein homolog OS=Drosophila melanogaster OX=7227 GN=Sh3beta PE=1 SV=2
5	Q9H299	3.33e-18	74.7	93	0.364	0.419	SH3L3_HUMAN SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
6	B2RZ27	4.05e-18	74.7	93	0.364	0.419	SH3L3_RAT SH3 domain-binding glutamic acid-rich-like protein 3 OS=Rattus norvegicus OX=10116 GN=Sh3bgrl3 PE=1 SV=1
7	Q5T123	3.85e-10	53.9	88	0.262	0.318	Q5T123_HUMAN SH3 domain binding glutamate rich protein like 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1
8	A0A517FNC7	0.25	32.3	497	0.159	0.034	94D18_PARPY Cytochrome P450 CYP94D108 OS=Paris polyphylla OX=49666 GN=CYP94D108 PE=1 SV=1
9	Q57X23	0.51	31.2	270	0.234	0.093	Q57X23_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.210 PE=3 SV=1
10	Q588C6	1.2	30.4	816	0.103	0.013	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
11	Q76LC6	2.3	29.3	230	0.093	0.043	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
12	Q01978	4.4	28.5	658	0.140	0.023	TFE2_XENLA Transcription factor E2-alpha OS=Xenopus laevis OX=8355 GN=tcf3 PE=1 SV=1
13	H0Y8S7	4.6	28.5	201	0.084	0.045	H0Y8S7_HUMAN RNA binding motif protein 24 (Fragment) OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1
14	Q9UHI5	6.2	28.1	535	0.131	0.026	LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1
15	Q9UBC3	6.5	28.1	853	0.121	0.015	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
16	Q6GQD3	7.2	27.7	225	0.084	0.040	RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis OX=8355 GN=rbm24-a PE=2 SV=1
17	Q5ZMA3	7.6	27.7	225	0.084	0.040	RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus OX=9031 GN=RBM24 PE=1 SV=2
18	M0R7T6	7.9	27.7	236	0.084	0.038	RBM24_RAT RNA-binding protein 24 OS=Rattus norvegicus OX=10116 GN=Rbm24 PE=3 SV=4
19	A8KAI7	8.2	27.7	236	0.084	0.038	A8KAI7_HUMAN RNA binding motif protein 24, isoform CRA_a OS=Homo sapiens OX=9606 GN=RBM24 PE=2 SV=1
20	Q9BX46	8.2	27.7	236	0.084	0.038	RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00462 Glutaredoxin	0.00077	31.0	Glutaredoxin
2	PF13102 Phage_int_SAM_5	3.4e+02	13.0	Phage integrase SAM-like domain
3	PF04908 SH3BGR	4.1e-45	163.3	SH3-binding, glutamic acid-rich protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358853

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376686	0.528	Lebercilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990756	0.343	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0080090	0.976	regulation of primary metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0048518	0.973	positive regulation of biological process
GO:0044237	0.973	cellular metabolic process
GO:0044238	0.969	primary metabolic process
GO:0010468	0.969	regulation of gene expression
GO:0006807	0.966	nitrogen compound metabolic process
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0071704	0.953	organic substance metabolic process
GO:0009893	0.925	positive regulation of metabolic process
GO:0048522	0.880	positive regulation of cellular process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:1901564	0.856	organonitrogen compound metabolic process
GO:0043170	0.855	macromolecule metabolic process
GO:0051173	0.847	positive regulation of nitrogen compound metabolic process
GO:0031325	0.847	positive regulation of cellular metabolic process
GO:2000112	0.747	regulation of cellular macromolecule biosynthetic process
GO:0010608	0.708	post-transcriptional regulation of gene expression
GO:0034248	0.703	regulation of amide metabolic process
GO:0006417	0.691	regulation of translation
GO:0019538	0.670	protein metabolic process
GO:0010557	0.637	positive regulation of macromolecule biosynthetic process
GO:0031328	0.632	positive regulation of cellular biosynthetic process
GO:0044260	0.628	cellular macromolecule metabolic process
GO:0051247	0.442	positive regulation of protein metabolic process
GO:0045727	0.366	positive regulation of translation
GO:0043632	0.360	modification-dependent macromolecule catabolic process
GO:0051603	0.357	proteolysis involved in protein catabolic process
GO:0019941	0.353	modification-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016020	0.966	membrane
GO:0005737	0.966	cytoplasm
GO:0012505	0.889	endomembrane system
GO:0031967	0.704	organelle envelope
GO:0031090	0.684	organelle membrane
GO:0005635	0.628	nuclear envelope
GO:0031965	0.576	nuclear membrane
GO:0042995	0.573	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]