StarFunc result for job id Q9UJD0

User Input

>input (308 residues)
MFNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLT
QWSKSTLQLPQPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGT
FIFPTTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIMDRSGQLEVEVIEARG
LTPKPGSKSLPATYIKVYLLENGACLAKKKTKMTKKTCDPLYQQALLFDEGPQGKVLQVI
VWGDYGRMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLE
SATSPSCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJD0	1.000	1.000	4.025E-48	308	1.000	1.000	Q9UJD0.pdb.gz	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
2	AFDB:Q86UR5	0.503	0.098	9.775E-33	1692	0.666	0.121	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
3	AFDB:Q99NE5	0.512	0.117	2.698E-32	1463	0.656	0.138	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
4	AFDB:Q9JIS1	0.510	0.106	8.741E-32	1555	0.659	0.131	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
5	AFDB:P60191	0.527	0.598	5.072E-30	269	0.461	0.528	P60191.pdb.gz	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
6	AFDB:Q9UQ26	0.505	0.114	4.076E-29	1411	0.591	0.129	Q9UQ26.pdb.gz	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
7	AFDB:M9PE32	0.424	0.105	2.911E-15	1314	0.211	0.049	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
8	AFDB:C0HDP4	0.393	0.245	1.973E-12	504	0.172	0.105	C0HDP4.pdb.gz	C0HDP4_DROME MIP05618p OS=Drosophila melanogaster OX=7227 GN=Sytalpha PE=2 SV=1
9	AFDB:Q8IYJ3	0.353	0.197	8.308E-11	562	0.192	0.105	Q8IYJ3.pdb.gz	SYTL1_HUMAN Synaptotagmin-like protein 1 OS=Homo sapiens OX=9606 GN=SYTL1 PE=1 SV=1
10	AFDB:P47709	0.359	0.168	9.245E-11	684	0.195	0.088	P47709.pdb.gz	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
11	PDB:3pfqA	0.361	0.220	4.944E-9	523	0.110	0.065	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:1cjyA	0.274	0.140	2.540E-4	633	0.055	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5izrC	0.266	0.131	2.540E-4	659	0.078	0.036	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:3nsjA	0.212	0.129	4.108E-4	530	0.071	0.042	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
15	PDB:5ixcA	0.282	0.133	4.572E-4	684	0.065	0.029	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:4gnkB	0.244	0.104	7.395E-4	769	0.065	0.026	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
17	PDB:5a52A	0.218	0.415	7.395E-4	154	0.062	0.123	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a50A	0.221	0.396	9.157E-4	165	0.058	0.109	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:7lq1A	0.236	0.081	1.262E-3	950	0.049	0.016	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
20	PDB:6pyuA	0.235	0.082	1.481E-3	930	0.049	0.016	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80U57	0.0	613	307	0.977	0.980	RIMS3_MOUSE Regulating synaptic membrane exocytosis protein 3 OS=Mus musculus OX=10090 GN=Rims3 PE=1 SV=2
2	Q9JIR3	0.0	611	307	0.971	0.974	RIMS3_RAT Regulating synaptic membrane exocytosis protein 3 OS=Rattus norvegicus OX=10116 GN=Rims3 PE=1 SV=1
3	Q9UJD0	0.0	629	308	1.000	1.000	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
4	Q9EQZ7	9.62e-132	410	1530	0.649	0.131	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
5	Q9JIS1	3.25e-131	409	1555	0.649	0.129	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	Q86UR5	3.54e-128	402	1692	0.653	0.119	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
7	Q99NE5	4.83e-122	383	1463	0.646	0.136	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
8	Q9JIR4	5.96e-122	384	1615	0.646	0.123	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
9	Q9UQ26	3.41e-113	358	1411	0.562	0.123	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
10	Q9H426	3.64e-96	286	269	0.464	0.532	RIMS4_HUMAN Regulating synaptic membrane exocytosis protein 4 OS=Homo sapiens OX=9606 GN=RIMS4 PE=1 SV=3
11	P60191	5.45e-96	286	269	0.461	0.528	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
12	Q8CIX1	1.01e-94	283	269	0.458	0.524	RIMS4_RAT Regulating synaptic membrane exocytosis protein 4 OS=Rattus norvegicus OX=10116 GN=Rims4 PE=1 SV=1
13	A0A0B4K7E1	3.51e-52	186	1955	0.289	0.046	A0A0B4K7E1_DROME Rab3 interacting molecule, isoform U OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
14	A0A0B4K679	3.65e-52	186	1965	0.292	0.046	A0A0B4K679_DROME Rab3 interacting molecule, isoform V OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
15	A0A0B4K742	3.88e-52	186	2595	0.289	0.034	A0A0B4K742_DROME Rab3 interacting molecule, isoform W OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
16	A0A0B4K6B7	4.36e-52	186	1655	0.292	0.054	A0A0B4K6B7_DROME Rab3 interacting molecule, isoform Z OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
17	A0A0B4K6M2	6.02e-52	186	2798	0.292	0.032	A0A0B4K6M2_DROME Rab3 interacting molecule, isoform F OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
18	A0A0B4K7F3	7.24e-51	182	1399	0.266	0.059	A0A0B4K7F3_DROME Rab3 interacting molecule, isoform S OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
19	A0A0B4KG75	8.88e-51	182	1358	0.266	0.060	A0A0B4KG75_DROME Rab3 interacting molecule, isoform AA OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
20	Q9VEE5	9.34e-51	182	1931	0.266	0.042	Q9VEE5_DROME Rab3 interacting molecule, isoform Q OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	8.1e-12	56.7	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321951	0.735	Protein lifeguard 2
2	9606.ENSP00000321627	0.713	Ankyrin repeat and fibronectin type III domain containing 1
3	9606.ENSP00000285243	0.674	Ankyrin repeat domain-containing protein 40
4	9606.ENSP00000417510	0.662	SPT20 homolog, SAGA complex component
5	9606.ENSP00000284476	0.642	Protein dispatched homolog 1
6	9606.ENSP00000335614	0.628	Liprin-alpha-3
7	9606.ENSP00000415332	0.625	SEC14 domain and spectrin repeat-containing protein 1
8	9606.ENSP00000368278	0.580	Interleukin-1 receptor accessory protein-like 1
9	9606.ENSP00000340914	0.558	Synaptotagmin-3
10	9606.ENSP00000351591	0.558	Neuroligin-3
11	9606.ENSP00000264042	0.543	FERM, ARHGEF and pleckstrin domain-containing protein 2
12	9606.ENSP00000420849	0.542	Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family
13	9606.ENSP00000357067	0.521	G protein-activated inward rectifier potassium channel 3
14	9606.ENSP00000429562	0.520	Protein unc-13 homolog A
15	9606.ENSP00000375836	0.512	Vigilin
16	9606.ENSP00000352540	0.511	Epithelial membrane protein 2
17	9606.ENSP00000216237	0.508	Lethal(3)malignant brain tumor-like protein 2
18	9606.ENSP00000261655	0.501	RIMS-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065008	0.998	regulation of biological quality
GO:0050789	0.958	regulation of biological process
GO:0009987	0.953	cellular process
GO:0050794	0.850	regulation of cellular process
GO:0051179	0.347	localization
GO:0006810	0.307	transport
GO:0051049	0.307	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	1.000	synapse
GO:0005622	0.977	intracellular anatomical structure
GO:0005737	0.926	cytoplasm
GO:0005829	0.906	cytosol
GO:0098793	0.905	presynapse
GO:0016020	0.871	membrane
GO:0043226	0.754	organelle
GO:0048786	0.655	presynaptic active zone
GO:0071944	0.541	cell periphery
GO:0098978	0.380	glutamatergic synapse
GO:0005886	0.374	plasma membrane
GO:0043229	0.365	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]