StarFunc result for job id Q9UJF2

User Input

>input (1139 residues)
MQTPEVPAERSPRRRSISGTSTSEKPNSMDTANTSPFKVPGFFSKRLKGSIKRTKSQSKL
DRNTSFRLPSLRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGEPVSVKPLHSSI
LGQDFCFEVTYLSGSKCFSCNSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKD
LAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFFSLPPLHSITVHIYKDVEKKKK
KDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTGGPSIRIKSRFQTITILPMEQ
YKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRC
GEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSEL
IDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLR
FLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAFMNDFLEHE
WGGMKRFLLEISNPDTISNTPGFDGYIDLGRELSVLHSLLWEVVSQLDKGENSFLQATVA
KLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPTDSDLHK
LKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESSLPNGRSVSLMDLQDTHAAQV
EHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPALNQPGGLQPLS
FQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQ
SEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSM
SVVSAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTA
AWVLNNGQYEEDVEETEQNLDEAKHAEKYEQEITKLKERLRVSSRRLEEYERRLLVQEQQ
MQKLLLEYKARLEDSEERLRRQQEEKDSQMKSIISRLMAVEEELKKDHAEMQAVIDAKQK
IIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISPTNPTKLSITENGEFKNSSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UHC7	0.619	0.595	1.311E-93	1189	0.589	0.564	Q3UHC7.pdb.gz	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
2	AFDB:E9QHX3	0.453	0.415	1.408E-72	1246	0.457	0.418	E9QHX3.pdb.gz
3	PDB:7r04A	0.238	0.119	1.814E-12	2326	0.077	0.038	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
4	PDB:7pgrN	0.231	0.114	2.186E-12	2423	0.082	0.038	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
5	PDB:7mp5A	0.225	0.159	4.004E-12	1629	0.074	0.052	7mp5A.pdb.gz
6	PDB:7r03B	0.227	0.119	5.691E-11	2246	0.076	0.039	7r03B.pdb.gz
7	PDB:7r04B	0.202	0.104	8.260E-11	2229	0.068	0.035	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
8	PDB:1cjyA	0.093	0.163	3.135E-7	633	0.038	0.068	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	PDB:7lq1A	0.091	0.107	1.030E-5	950	0.057	0.068	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
10	PDB:6pyuA	0.086	0.104	1.300E-5	930	0.058	0.071	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
11	PDB:6kz8A	0.092	0.131	3.300E-5	784	0.020	0.029	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
12	PDB:5ixcA	0.092	0.148	4.165E-5	684	0.017	0.028	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	AFDB:Q8TEU7	0.050	0.045	2.749E-4	1601	0.114	0.081	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
14	AFDB:Q9Y4G8	0.047	0.040	5.527E-4	1499	0.119	0.091	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
15	AFDB:Q9H254	0.056	0.031	9.664E-4	2564	0.094	0.042	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
16	AFDB:Q07889	0.050	0.047	2.133E-3	1333	0.104	0.089	Q07889.pdb.gz	SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1
17	AFDB:Q54LJ4	0.069	0.038	2.234E-3	2563	0.104	0.046	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
18	AFDB:P48415	0.063	0.040	2.954E-3	2195	0.130	0.067	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
19	AFDB:E9PD50	0.076	0.075	5.670E-3	1170	0.080	0.078	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
20	AFDB:F1R8J2	0.068	0.050	6.831E-3	2014	0.127	0.072	F1R8J2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YUS5	0.0	2276	1261	0.965	0.872	D3YUS5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
2	E7F1U4	0.0	843	1507	0.351	0.265	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
3	E9PW37	0.0	2297	1286	0.971	0.860	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
4	F6SEU4	0.0	827	1340	0.394	0.335	SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus OX=10090 GN=Syngap1 PE=1 SV=2
5	Q0VAV5	0.0	2294	1268	0.970	0.871	Q0VAV5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=1
6	Q3UHC7	0.0	1243	1189	0.595	0.570	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
7	Q5VWQ8	0.0	1242	1189	0.597	0.572	DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2
8	Q6P730	0.0	1061	996	0.507	0.580	DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1
9	Q96PV0	0.0	825	1343	0.387	0.328	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
10	Q9QUH6	0.0	829	1308	0.394	0.343	SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus OX=10116 GN=Syngap1 PE=1 SV=2
11	Q9UJF2	0.0	2358	1139	1.000	1.000	NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2
12	D3YWZ9	9.43e-163	486	323	0.203	0.715	D3YWZ9_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
13	Q8BU92	4.03e-159	479	383	0.198	0.590	Q8BU92_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=2
14	Q8T498	1.13e-146	481	1580	0.225	0.162	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
15	Q86YV0	2.17e-138	446	1011	0.218	0.245	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
16	Q8MLZ5	8.36e-135	442	1207	0.210	0.198	GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2
17	D3Z1T6	3.06e-116	358	176	0.151	0.977	D3Z1T6_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
18	D3Z7S1	9.31e-76	248	147	0.106	0.823	D3Z7S1_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
19	Q3V090	1.09e-45	179	742	0.127	0.195	Q3V090_MOUSE Ras GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
20	P50904	1.83e-45	181	1038	0.127	0.140	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05791 Bacillus_HBL	3.1e+02	12.6	Bacillus haemolytic enterotoxin (HBL)
2	PF00168 C2	1.3e-05	36.8	C2 domain
3	PF12004 DUF3498	6.8e-197	667.4	Domain of unknown function (DUF3498)
4	PF16046 FAM76	6.7e+02	11.1	FAM76 protein
5	PF14662 KASH_CCD	67	14.8	Coiled-coil region of CCDC155 or KASH
6	PF00169 PH	1.1e+02	14.7	PH domain
7	PF00616 RasGAP	2e-23	94.8	GTPase-activator protein for Ras-like GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000005865

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000015727	0.954	Belongs to the TNF receptor-associated factor family.
2	9555.ENSPANP00000007708	0.903	Mitogen-activated protein kinase kinase kinase 15
3	9555.ENSPANP00000015418	0.903	Mitogen-activated protein kinase kinase kinase 5
4	9555.ENSPANP00000005038	0.900	KRAS proto-oncogene, GTPase
5	9555.ENSPANP00000006713	0.900	Muscle RAS oncogene homolog
6	9555.ENSPANP00000011191	0.900	NRAS proto-oncogene, GTPase
7	9555.ENSPANP00000004916	0.899	Related RAS viral (r-ras) oncogene homolog 2
8	9555.ENSPANP00000004260	0.892	Related RAS viral (r-ras) oncogene homolog
9	9555.ENSPANP00000001229	0.874	Uncharacterized protein
10	9555.ENSPANP00000001773	0.862	annotation not available
11	9555.ENSPANP00000015001	0.847	Mitogen-activated protein kinase kinase kinase 6
12	9555.ENSPANP00000018929	0.804	TNF receptor-associated factor 1
13	9555.ENSPANP00000009314	0.705	Zinc finger CCHC-type and RNA binding motif 1
14	9555.ENSPANP00000003878	0.670	Receptor protein-tyrosine kinase
15	9555.ENSPANP00000018119	0.668	RAS-like, estrogen-regulated, growth inhibitor
16	9555.ENSPANP00000002959	0.666	Receptor protein-tyrosine kinase
17	9555.ENSPANP00000007344	0.666	Erb-b2 receptor tyrosine kinase 3
18	9555.ENSPANP00000020554	0.666	Receptor protein-tyrosine kinase
19	9555.ENSPANP00000008454	0.662	Ligand of numb-protein X 1, E3 ubiquitin protein ligase
20	9555.ENSPANP00000008807	0.658	Tumor necrosis factor receptor superfamily, member 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0019899	0.981	enzyme binding
GO:0019901	0.958	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0009987	0.974	cellular process
GO:0050794	0.964	regulation of cellular process
GO:0023052	0.949	signaling
GO:0007154	0.948	cell communication
GO:0032501	0.893	multicellular organismal process
GO:0051716	0.876	cellular response to stimulus
GO:0032502	0.872	developmental process
GO:0007165	0.869	signal transduction
GO:0048856	0.856	anatomical structure development
GO:0019222	0.835	regulation of metabolic process
GO:0048513	0.762	animal organ development
GO:0071704	0.694	organic substance metabolic process
GO:0060255	0.691	regulation of macromolecule metabolic process
GO:0080090	0.689	regulation of primary metabolic process
GO:0051171	0.650	regulation of nitrogen compound metabolic process
GO:0043170	0.629	macromolecule metabolic process
GO:0007275	0.616	multicellular organism development
GO:0042221	0.535	response to chemical
GO:0051246	0.524	regulation of protein metabolic process
GO:0048731	0.501	system development
GO:0010033	0.484	response to organic substance
GO:0048583	0.434	regulation of response to stimulus
GO:0031323	0.430	regulation of cellular metabolic process
GO:0010468	0.424	regulation of gene expression
GO:0023051	0.408	regulation of signaling
GO:0010646	0.408	regulation of cell communication
GO:0048518	0.401	positive regulation of biological process
GO:0009966	0.401	regulation of signal transduction
GO:1902531	0.392	regulation of intracellular signal transduction
GO:0048522	0.344	positive regulation of cellular process
GO:0044238	0.335	primary metabolic process
GO:0048519	0.329	negative regulation of biological process
GO:0006807	0.322	nitrogen compound metabolic process
GO:0048523	0.312	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0016020	0.987	membrane
GO:0071944	0.976	cell periphery
GO:0005886	0.965	plasma membrane
GO:0043226	0.885	organelle
GO:0043227	0.794	membrane-bounded organelle
GO:0043229	0.749	intracellular organelle
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0032991	0.541	protein-containing complex
GO:0012505	0.433	endomembrane system
GO:0030424	0.387	axon
GO:1990597	0.382	AIP1-IRE1 complex
GO:1990032	0.381	parallel fiber
GO:0044301	0.381	climbing fiber
GO:0044300	0.369	cerebellar mossy fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]