StarFunc result for job id Q9UJJ7

User Input

>input (312 residues)
MEPGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPELADPDTCYGF
RFCHQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIGR
NSTEGRAHTMCIEGSQGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHC
SALGHPVVGDLTYGEVSGREDRPFRMMLHAFYLRIPTDTECVEVCTPDPFLPSLDACWSP
HTLLQSLDQLVQALRATPDPDPEDRGPRPGSPSALLPGPGRPPPPPTKPPETEAQRGPCL
QWLSEWTLEPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJJ7	1.000	1.000	1.969E-63	312	1.000	1.000	Q9UJJ7.pdb.gz	RUSD1_HUMAN RNA pseudouridylate synthase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RPUSD1 PE=1 SV=1
2	AFDB:P0AA37	0.579	0.808	4.662E-20	219	0.218	0.311	P0AA37.pdb.gz	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
3	PDB:2i82A	0.571	0.799	9.683E-20	217	0.224	0.323	2i82A.pdb.gz	Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure
4	AFDB:P0AA39	0.574	0.562	1.564E-17	319	0.224	0.219	P0AA39.pdb.gz	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
5	PDB:2istA	0.573	0.558	2.196E-17	321	0.231	0.224	2istA.pdb.gz
6	AFDB:O25114	0.581	0.606	3.236E-17	298	0.186	0.195	O25114.pdb.gz	Y347_HELPY Uncharacterized RNA pseudouridine synthase HP_0347 OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0347 PE=1 SV=1
7	AFDB:P0AA41	0.592	0.702	4.786E-17	260	0.183	0.219	P0AA41.pdb.gz	TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=truC PE=1 SV=1
8	AFDB:Q9CWX4	0.620	0.522	7.486E-17	377	0.202	0.167	Q9CWX4.pdb.gz	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
9	AFDB:Q96CM3	0.629	0.528	1.464E-16	377	0.199	0.164	Q96CM3.pdb.gz	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
10	AFDB:P33643	0.577	0.553	1.832E-16	326	0.231	0.221	P33643.pdb.gz	RLUD_ECOLI Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=rluD PE=1 SV=4
11	AFDB:Q12362	0.573	0.313	4.007E-16	591	0.205	0.108	Q12362.pdb.gz	RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1
12	AFDB:Q3ECD0	0.597	0.442	4.481E-16	430	0.218	0.158	Q3ECD0.pdb.gz	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
13	PDB:6yxxEC	0.510	0.434	3.730E-14	373	0.170	0.142	6yxxEC.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
14	PDB:2olwA	0.366	0.602	8.918E-6	179	0.112	0.196	2olwA.pdb.gz
15	PDB:1kskA	0.361	0.464	1.247E-5	234	0.112	0.150	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
16	PDB:3dh3B	0.323	0.403	1.827E-4	241	0.099	0.129	3dh3B.pdb.gz	Crystal structure of an RluF-RNA complex: a base-pair rearrangement is the key to selectivity of RluF for U2604 of the ribosome.
17	PDB:7v9aC	0.315	0.259	1.809E-3	393	0.087	0.069	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
18	PDB:2v9kA	0.310	0.225	1.913E-3	467	0.099	0.066	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
19	PDB:2rfkA	0.284	0.270	6.546E-3	334	0.083	0.078	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
20	PDB:1sgvB	0.251	0.287	6.922E-3	266	0.093	0.109	1sgvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJJ7	0.0	641	312	1.000	1.000	RUSD1_HUMAN RNA pseudouridylate synthase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RPUSD1 PE=1 SV=1
2	P0AA37	6.62e-23	96.3	219	0.218	0.311	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
3	P33643	2.94e-15	77.4	326	0.183	0.175	RLUD_ECOLI Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=rluD PE=1 SV=4
4	P53294	1.66e-14	75.5	404	0.173	0.134	PUS6_YEAST tRNA pseudouridine(31) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS6 PE=1 SV=1
5	P0AA39	1.52e-13	72.0	319	0.179	0.176	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
6	O25114	1.73e-12	68.9	298	0.196	0.205	Y347_HELPY Uncharacterized RNA pseudouridine synthase HP_0347 OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0347 PE=1 SV=1
7	Q12069	2.45e-11	66.2	462	0.157	0.106	PUS9_YEAST tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS9 PE=1 SV=1
8	Q12362	3.89e-11	65.9	591	0.176	0.093	RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1
9	Q9LT72	2.59e-10	63.2	477	0.154	0.101	PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g19440 PE=2 SV=1
10	P0AA41	5.63e-10	61.2	260	0.160	0.192	TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=truC PE=1 SV=1
11	Q5XET6	1.03e-09	61.6	478	0.147	0.096	PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g78910 PE=2 SV=1
12	F4KBV6	6.49e-09	58.9	410	0.135	0.102	F4KBV6_ARATH Pseudouridine synthase OS=Arabidopsis thaliana OX=3702 GN=MWD22.8 PE=1 SV=1
13	Q8IZ73	1.24e-08	58.2	545	0.138	0.079	RUSD2_HUMAN Pseudouridylate synthase RPUSD2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2
14	O07166	1.80e-08	57.0	305	0.189	0.193	O07166_MYCTU Pseudouridine synthase RsuA/RluA-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3300c PE=4 SV=1
15	Q7XA65	1.76e-07	54.3	322	0.183	0.177	PUS1_ARATH RNA pseudouridine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=At1g56345 PE=2 SV=1
16	M9MRH0	2.80e-07	53.9	543	0.179	0.103	M9MRH0_DROME RluA pseudouridine synthase 2, isoform C OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=1
17	Q9VKU8	3.02e-07	53.9	547	0.179	0.102	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
18	Q3ECD0	3.22e-07	53.5	430	0.128	0.093	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
19	Q96CM3	1.32e-06	51.6	377	0.138	0.114	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
20	Q09709	4.67e-06	50.1	394	0.128	0.102	YA32_SCHPO Pseudouridylate synthase C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00849 PseudoU_synth_2	4.2e-21	87.2	RNA pseudouridylate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415899	0.786	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
2	9606.ENSP00000227474	0.750	tRNA pseudouridine(38/39) synthase
3	9606.ENSP00000262315	0.744	Chromosome transmission fidelity protein 18 homolog
4	9606.ENSP00000300087	0.742	Dynactin subunit 5
5	9606.ENSP00000348722	0.739	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
6	9606.ENSP00000373331	0.735	Mitochondrial mRNA pseudouridine synthase RPUSD3
7	9606.ENSP00000365837	0.720	tRNA pseudouridine synthase A
8	9606.ENSP00000361982	0.662	Mitochondrial mRNA pseudouridine synthase TRUB2
9	9606.ENSP00000326003	0.632	Putative tRNA pseudouridine synthase Pus10
10	9606.ENSP00000458770	0.631	Acyl carrier protein, mitochondrial
11	9606.ENSP00000351644	0.620	tRNA modification GTPase GTPBP3, mitochondrial
12	9606.ENSP00000298746	0.581	Probable tRNA pseudouridine synthase 1
13	9606.ENSP00000368318	0.568	Pseudouridylate synthase-like 1
14	9606.ENSP00000423933	0.563	THUMP domain-containing protein 2
15	9606.ENSP00000420682	0.556	Queuine tRNA-ribosyltransferase accessory subunit 2
16	9606.ENSP00000368987	0.552	Olfactory receptor 6C75
17	9606.ENSP00000339532	0.537	THUMP domain-containing protein 3
18	9606.ENSP00000455229	0.532	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
19	9606.ENSP00000363268	0.518	Putative uncharacterized protein C10orf128

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.985	catalytic activity
GO:0009982	0.979	pseudouridine synthase activity
GO:0003723	0.425	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0046483	0.987	heterocycle metabolic process
GO:0009451	0.976	RNA modification
GO:0034660	0.949	ncRNA metabolic process
GO:0034470	0.944	ncRNA processing
GO:0050789	0.832	regulation of biological process
GO:0006399	0.725	tRNA metabolic process
GO:0008033	0.717	tRNA processing
GO:0048518	0.642	positive regulation of biological process
GO:0001522	0.622	pseudouridine synthesis
GO:0006400	0.485	tRNA modification
GO:0050794	0.475	regulation of cellular process
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.995	nucleus
GO:0005829	0.950	cytosol
GO:0043233	0.935	organelle lumen
GO:0070013	0.931	intracellular organelle lumen
GO:0005739	0.900	mitochondrion
GO:0043232	0.758	intracellular non-membrane-bounded organelle
GO:0031981	0.703	nuclear lumen
GO:0005654	0.684	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	0.979	Intramolecular transferases.

[back to server]