StarFunc result for job id Q9UJM3

User Input

>input (462 residues)
MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSA
QERLIPLGHASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTV
NGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTD
FLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYVSDQNGGVPDPNPPPP
QTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVS
SKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I6S2Y9	0.274	0.274	2.283E-64	462	1.000	1.000	I6S2Y9.pdb.gz	I6S2Y9_HUMAN ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=4 SV=1
2	AFDB:Q99JZ7	0.410	0.410	1.227E-53	461	0.820	0.822	Q99JZ7.pdb.gz	ERRFI_MOUSE ERBB receptor feedback inhibitor 1 OS=Mus musculus OX=10090 GN=Errfi1 PE=1 SV=1
3	AFDB:A0A499FJ16	0.063	0.036	2.110E-10	1086	0.307	0.131	A0A499FJ16.pdb.gz	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
4	AFDB:P11161	0.083	0.082	8.232E-3	476	0.156	0.151	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
5	AFDB:Q57Y61	0.082	0.051	1.934E-2	899	0.110	0.057	Q57Y61.pdb.gz	Q57Y61_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.380 PE=4 SV=1
6	AFDB:Q8BSM5	0.062	0.051	2.869E-2	595	0.158	0.123	Q8BSM5.pdb.gz	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
7	AFDB:P08152	0.068	0.067	3.494E-2	470	0.169	0.166	P08152.pdb.gz	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
8	AFDB:A0A0B4KFL4	0.068	0.047	7.688E-2	882	0.141	0.074	A0A0B4KFL4.pdb.gz	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
9	AFDB:Q9VPM5	0.070	0.062	8.768E-2	539	0.154	0.132	Q9VPM5.pdb.gz	MBM_DROME Protein mushroom body miniature OS=Drosophila melanogaster OX=7227 GN=mbm PE=1 SV=1
10	AFDB:P70486	0.077	0.070	1.068E-1	527	0.128	0.112	P70486.pdb.gz	ATRX_RAT Transcriptional regulator ATRX (Fragment) OS=Rattus norvegicus OX=10116 GN=Atrx PE=1 SV=1
11	PDB:7ungi	0.065	0.085	4.532E-1	250	0.069	0.128	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:7rroi	0.046	0.077	1.385	235	0.050	0.098	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7b7da	0.051	0.184	1.580	87	0.015	0.080	7b7da.pdb.gz	eEF3 promotes late stages of tRNA translocation including E-tRNA release from the ribosome
14	PDB:6lthM	0.056	0.084	3.711	259	0.017	0.031	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
15	PDB:7pubIA	0.065	0.049	3.711	693	0.026	0.017	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:3j7aZ	0.050	0.193	3.963	72	0.017	0.111	3j7aZ.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:6id0W	0.059	0.054	4.233	509	0.052	0.047	6id0W.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:7vdvV	0.056	0.090	4.520	238	0.028	0.055	7vdvV.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:6sxaF	0.047	0.031	4.827	747	0.019	0.012	6sxaF.pdb.gz
20	PDB:7vl9R	0.046	0.066	4.827	302	0.013	0.020	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I6S2Y9	0.0	941	462	1.000	1.000	I6S2Y9_HUMAN ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=4 SV=1
2	P05432	0.0	700	459	0.825	0.830	ERRFI_RAT ERBB receptor feedback inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Errfi1 PE=1 SV=1
3	Q99JZ7	0.0	703	461	0.820	0.822	ERRFI_MOUSE ERBB receptor feedback inhibitor 1 OS=Mus musculus OX=10090 GN=Errfi1 PE=1 SV=1
4	Q9UJM3	0.0	941	462	1.000	1.000	ERRFI_HUMAN ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=1 SV=1
5	A0A499FJ16	1.04e-26	116	1086	0.236	0.100	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
6	C9J1X3	1.07e-26	116	1040	0.236	0.105	C9J1X3_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
7	A0A5F9ZGX5	1.11e-26	115	1055	0.236	0.103	A0A5F9ZGX5_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
8	A0A5F9ZHJ2	1.16e-26	115	1072	0.236	0.102	A0A5F9ZHJ2_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
9	A0A5F9ZHP4	1.23e-26	115	1008	0.236	0.108	A0A5F9ZHP4_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
10	Q17R13	1.29e-26	115	1039	0.227	0.101	ACK1_BOVIN Activated CDC42 kinase 1 OS=Bos taurus OX=9913 GN=TNK2 PE=1 SV=1
11	O54967	1.32e-26	115	1055	0.139	0.061	ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus OX=10090 GN=Tnk2 PE=1 SV=2
12	A0A5F9ZI29	1.34e-26	115	1040	0.236	0.105	A0A5F9ZI29_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
13	Q07912	1.46e-26	115	1038	0.236	0.105	ACK1_HUMAN Activated CDC42 kinase 1 OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=3
14	Q5U2X5	7.54e-22	101	1040	0.119	0.053	ACK1_RAT Activated CDC42 kinase 1 OS=Rattus norvegicus OX=10116 GN=Tnk2 PE=2 SV=1
15	A1Z9I8	0.090	38.1	5385	0.067	0.006	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	B7YZG2	0.090	38.1	5370	0.067	0.006	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A0A0B4K7P8	0.093	38.1	5394	0.067	0.006	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	A0A0B4K7Y9	0.094	38.1	5408	0.067	0.006	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	A1Z9I9	0.094	38.1	5390	0.067	0.006	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	B7YZG3	0.094	38.1	5375	0.067	0.006	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09027 GTPase_binding	0.017	26.4	GTPase binding
2	PF11555 Inhibitor_Mig-6	0.00014	33.4	EGFR receptor inhibitor Mig-6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000383118	0.867	Cell division control protein 42 homolog
3	9606.ENSP00000376345	0.836	Growth factor receptor-bound protein 2
4	9606.ENSP00000289877	0.703	Proton-associated sugar transporter A
5	9606.ENSP00000310117	0.680	Protein phosphatase 1 regulatory subunit 14B
6	9606.ENSP00000318429	0.667	Coiled-coil domain-containing protein 114
7	9606.ENSP00000362036	0.573	Mitochondrial ribosomal protein S16
8	9606.ENSP00000312587	0.570	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
9	9606.ENSP00000358814	0.557	S-adenosylhomocysteine hydrolase-like protein 1
10	9606.ENSP00000269571	0.538	Receptor tyrosine-protein kinase erbB-2
11	9606.ENSP00000358755	0.533	Acidic mammalian chitinase
12	9606.ENSP00000362680	0.524	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000371397	0.520	Protein FAM43A
14	9606.ENSP00000235835	0.513	Aflatoxin B1 aldehyde reductase member 2
15	9606.ENSP00000456480	0.503	Sorting nexin 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.594	enzyme binding
GO:0003824	0.526	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0009892	0.957	negative regulation of metabolic process
GO:0009966	0.956	regulation of signal transduction
GO:0045859	0.952	regulation of protein kinase activity
GO:0051248	0.949	negative regulation of protein metabolic process
GO:0009968	0.948	negative regulation of signal transduction
GO:0031324	0.947	negative regulation of cellular metabolic process
GO:0044092	0.941	negative regulation of molecular function
GO:0043086	0.917	negative regulation of catalytic activity
GO:0045936	0.917	negative regulation of phosphate metabolic process
GO:0031400	0.915	negative regulation of protein modification process
GO:0061097	0.914	regulation of protein tyrosine kinase activity
GO:0051348	0.913	negative regulation of transferase activity
GO:0042058	0.913	regulation of epidermal growth factor receptor signaling pathway
GO:0001933	0.911	negative regulation of protein phosphorylation
GO:0010469	0.903	regulation of signaling receptor activity
GO:1901185	0.901	negative regulation of ERBB signaling pathway
GO:0050732	0.900	negative regulation of peptidyl-tyrosine phosphorylation
GO:0006469	0.893	negative regulation of protein kinase activity
GO:0042059	0.890	negative regulation of epidermal growth factor receptor signaling pathway
GO:0009987	0.625	cellular process
GO:0051239	0.512	regulation of multicellular organismal process
GO:0050896	0.491	response to stimulus
GO:0051716	0.358	cellular response to stimulus
GO:0048518	0.352	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0005886	0.932	plasma membrane
GO:0043231	0.480	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]