StarFunc result for job id Q9UJS0

User Input

>input (675 residues)
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAIGGGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QXX4	0.936	0.934	8.383E-90	676	0.956	0.954	Q9QXX4.pdb.gz	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
2	AFDB:O75746	0.518	0.516	4.597E-78	678	0.772	0.768	O75746.pdb.gz	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
3	AFDB:Q9VA73	0.483	0.470	3.612E-64	695	0.570	0.554	Q9VA73.pdb.gz	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
4	AFDB:Q5AL11	0.432	0.400	3.957E-38	731	0.336	0.311	Q5AL11.pdb.gz	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
5	AFDB:Q12482	0.418	0.315	3.027E-33	902	0.324	0.243	Q12482.pdb.gz	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
6	AFDB:Q9VGF7	0.386	0.795	4.356E-20	321	0.182	0.383	Q9VGF7.pdb.gz	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
7	AFDB:A0A0G2K5L2	0.386	0.783	2.378E-19	323	0.188	0.393	A0A0G2K5L2.pdb.gz	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
8	AFDB:Q9H1K4	0.377	0.790	4.308E-19	315	0.188	0.403	Q9H1K4.pdb.gz	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
9	AFDB:Q505J6	0.385	0.794	8.141E-19	320	0.188	0.397	Q505J6.pdb.gz	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
10	AFDB:Q9FI43	0.379	0.512	8.666E-17	487	0.138	0.191	Q9FI43.pdb.gz	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
11	PDB:4c9qB	0.362	0.796	6.905E-12	290	0.114	0.266	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.342	0.732	6.012E-11	293	0.117	0.270	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.289	0.573	3.646E-8	292	0.111	0.257	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:6iihA	0.186	0.254	8.789E-7	446	0.089	0.135	6iihA.pdb.gz	The crystal structure of MICU2 provides insight into Ca2+binding and MICU1-MICU2 heterodimer formation.
15	PDB:6xjxQ	0.194	0.312	2.306E-5	367	0.110	0.202	6xjxQ.pdb.gz
16	PDB:6k7yI	0.201	0.376	4.359E-5	306	0.107	0.235	6k7yI.pdb.gz	Structure of intact human MCU supercomplex with the auxiliary MICU subunits.
17	PDB:7nmiB	0.092	0.123	2.673E-3	488	0.107	0.148	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
18	PDB:2lmtA	0.101	0.404	6.516E-3	148	0.047	0.216	2lmtA.pdb.gz	Structure of androcam supports specialized interactions with myosin VI.
19	PDB:6tz8B	0.159	0.503	6.516E-3	174	0.046	0.178	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
20	PDB:5x9aB	0.165	0.427	1.131E-2	198	0.047	0.162	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LX07	0.0	1066	676	0.754	0.753	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
2	O75746	0.0	1093	678	0.772	0.768	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
3	Q8BH59	0.0	1090	677	0.764	0.762	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
4	Q9QXX4	0.0	1329	676	0.956	0.954	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
5	Q9UJS0	0.0	1384	675	1.000	1.000	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
6	Q9VA73	0.0	790	695	0.579	0.563	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
7	Q5AL11	2.37e-97	317	731	0.338	0.312	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
8	Q12482	1.53e-95	316	902	0.249	0.186	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
9	Q9VGF7	2.31e-63	215	321	0.172	0.361	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
10	Q8INJ3	1.39e-62	213	319	0.179	0.379	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
11	Q9H1K4	3.79e-62	211	315	0.188	0.403	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
12	Q9DB41	2.70e-61	209	320	0.185	0.391	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
13	Q9H936	5.02e-60	206	323	0.188	0.393	GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1
14	A0A0G2K5L2	1.50e-59	204	323	0.188	0.393	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
15	Q9D6M3	2.77e-59	204	323	0.188	0.393	GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus OX=10090 GN=Slc25a22 PE=1 SV=1
16	Q505J6	1.97e-58	201	320	0.178	0.375	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
17	A8WHE0	4.08e-43	157	240	0.136	0.383	A8WHE0_DROME AT11783p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
18	Q99297	9.43e-35	136	307	0.139	0.306	ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC2 PE=1 SV=1
19	Q8RWA5	1.49e-34	137	363	0.136	0.253	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
20	Q9SUV1	9.43e-34	135	392	0.123	0.212	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.0027	28.2	EF hand
2	PF13202 EF-hand_5	11	16.9	EF hand
3	PF13405 EF-hand_6	0.00011	32.7	EF-hand domain
4	PF13499 EF-hand_7	3.2e-07	42.0	EF-hand domain pair
5	PF13833 EF-hand_8	0.41	21.8	EF-hand domain pair
6	PF00153 Mito_carr	8.8e-69	238.8	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033227

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017401	0.761	Translocase of inner mitochondrial membrane 13 homolog
2	9598.ENSPTRP00000038031	0.743	Translocase of inner mitochondrial membrane 8 homolog A
3	9598.ENSPTRP00000035371	0.710	Cytochrome c-1
4	9598.ENSPTRP00000036742	0.677	Argininosuccinate synthetase 1
5	9598.ENSPTRP00000012474	0.611	Cytochrome c oxidase subunit 5A, mitochondrial
6	9598.ENSPTRP00000045981	0.591	Uncharacterized protein
7	9598.ENSPTRP00000028239	0.590	Solute carrier family 7, (Cationic amino acid transporter, y+ system) member 11
8	9598.ENSPTRP00000024853	0.580	Uncharacterized protein
9	9598.ENSPTRP00000032342	0.577	Uncharacterized protein
10	9598.ENSPTRP00000006962	0.568	Uncharacterized protein
11	9598.ENSPTRP00000027765	0.553	Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin
12	9598.ENSPTRP00000004309	0.531	Mitochondrial import inner membrane translocase subunit TIM23
13	9598.ENSPTRP00000009015	0.525	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
14	9598.ENSPTRP00000010848	0.516	Translocase of inner mitochondrial membrane 9 homolog
15	9598.ENSPTRP00000041660	0.505	Enoyl-CoA hydratase, short chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.997	salt transmembrane transporter activity
GO:0042887	0.997	amide transmembrane transporter activity
GO:0015179	0.997	L-amino acid transmembrane transporter activity
GO:0015172	0.997	acidic amino acid transmembrane transporter activity
GO:0005488	0.962	binding
GO:0005515	0.921	protein binding
GO:0043167	0.920	ion binding
GO:0046872	0.823	metal ion binding
GO:0022804	0.803	active transmembrane transporter activity
GO:0015291	0.709	secondary active transmembrane transporter activity
GO:0015318	0.707	inorganic molecular entity transmembrane transporter activity
GO:0005509	0.647	calcium ion binding
GO:0015297	0.496	antiporter activity
GO:0015556	0.490	C4-dicarboxylate transmembrane transporter activity
GO:0005313	0.471	L-glutamate transmembrane transporter activity
GO:1901682	0.451	sulfur compound transmembrane transporter activity
GO:0072349	0.442	modified amino acid transmembrane transporter activity
GO:0015078	0.385	proton transmembrane transporter activity
GO:0005310	0.310	dicarboxylic acid transmembrane transporter activity
GO:0022853	0.308	active monoatomic ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006091	0.995	generation of precursor metabolites and energy
GO:0022900	0.994	electron transport chain
GO:0045333	0.992	cellular respiration
GO:1990542	0.987	mitochondrial transmembrane transport
GO:0044281	0.968	small molecule metabolic process
GO:0022904	0.958	respiratory electron transport chain
GO:0071704	0.956	organic substance metabolic process
GO:0044238	0.953	primary metabolic process
GO:0071702	0.840	organic substance transport
GO:0009058	0.799	biosynthetic process
GO:1901576	0.785	organic substance biosynthetic process
GO:0046942	0.749	carboxylic acid transport
GO:0071705	0.720	nitrogen compound transport
GO:1905039	0.696	carboxylic acid transmembrane transport
GO:0044283	0.679	small molecule biosynthetic process
GO:0003333	0.676	amino acid transmembrane transport
GO:0006835	0.667	dicarboxylic acid transport
GO:0006094	0.603	gluconeogenesis
GO:0015740	0.514	C4-dicarboxylate transport
GO:0006807	0.459	nitrogen compound metabolic process
GO:1901564	0.306	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0031974	0.466	membrane-enclosed lumen
GO:0070013	0.464	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:66336	0.471	L-glutamate(out) = L-glutamate(in)

[back to server]